(Journal of Leukocyte Biology. 2000;68:331-337.)
© 2000
by Society for Leukocyte Biology
HIV-1 replication in CD4+ T cell lines: the effects of adaptation on co-receptor use, tropism, and accessory gene function
Nathalie Dejucq
Wohl Virion Centre, Windeyer Institute of Medical Sciences, London, United Kingdom
Correspondence and current address: Dr. Nathalie Dejucq, GERM-INSERM U435, Campus de Beaulieu, 35 042 Rennes Cedex, France. E-mail: nathalie.dejucq{at}rennes.inserm.fr

ABSTRACT
We studied the replication of HIV-1 macrophage-tropic CCR5-using
strains
(R5) in CD4
+ T cell lines to better understand the
switch in
co-receptor use of such strains during disease progression
and
to assess resulting changes in cell tropism. We found that the
majority
of R5 strains cannot replicate in CD4
+ T cell
lines without
adaptation by serial passage. A small minority of primary
R5
isolates, however, were able to infect two T cell lines, Molt4
and
SupT1. This expanded tropism was due to the use of undetectable
levels
of CCR5 rather than CXCR4 or alternative receptors. In
contrast,
HIV-1
SF162 adaptation for replication in the C8166
T cell
line was due to the emergence of variant strains that
could use CXCR4.
Of two variants, one was dual-tropic and one
T-tropic, although both
could use CCR5 as well as CXCR4. A single
mutation in the start codon
of the accessory gene
vpu accounted
for the T-tropic
phenotype of the second variant, indicating
that a non-functional
vpu impairs macrophage tropism. Thus,
in vitro
and in the absence of an immune response, R5 strains
naturally adapt to
infect CXCR4
+ T cell lines. Such adaptation
resembles the
rare R5 to X4 switch that occurs
in vivo. Mutations
in
accessory genes (e.g.,
vpu) not required for replication
in
rapidly dividing cell lines may also occur
in vitro,
abrogating
replication in primary cell types such as macrophages. Such
mutations,
however, are normally selected against
in
vivo.
Key Words: macrophage and T cell lines tropism CXCR4 CCR5 Vpu

INTRODUCTION
Changes in cellular tropism by HIV-1 strains seem to be a key
event
in the pathogenesis of HIV disease [
1
2
3
4
5
6
] because
in
half of HIV-infected individuals the emergence of T cell line
tropic
variants is associated with the development of AIDS [
6
,
7
].
HIV-1 isolates have been classified into two main
types: (1)
syncytium-inducing (SI), T cell line tropic (T-tropic),
rapid/high
strains and (2) non-syncytium-inducing (NSI),
macrophage-tropic
(M-tropic), slow/low strains.
In vitro,
NSI viruses infect both
macrophages and T cells, which are important
cell targets for
the virus
in vivo, but rarely infect T cell
lines. In contrast,
SI viruses replicate in a range of transformed
CD4
+ T cell lines
[
8
], while their capacity
to infect macrophages has been controversial
[
4
,
9
10
11
12
13
14
15
]. During primary acute infection,
the majority of
HIV-1 isolates are NSI [
16
], whereas SI strains
emerge
during disease progression in about 50% of AIDS patients
[
5
].
This emergence often precedes or coincides with a
rapid decline
in CD4
+ cells in blood [
17
].
The selective pressures that drive
or prevent this switch are still
poorly understood.
Two receptors are required on the surface of the target cell to trigger
HIV entry: the CD4 receptor and a co-receptor [18
19
20
].
Co-receptors have seven transmembrane domains (7TM) and are either
members of, or related to, the chemokine receptor family. At least 12
7TM receptors have been shown to act as co-receptors for entry of
different HIV-1 strains in vitro [see 21 24 for
reviews]. All HIV-1 strains studied so far, however, use CCR5, CXCR4,
or both [14
, 25
]. The discovery of HIV
co-receptors has mainly explained the NSI/ M-tropic versus SI/T-tropic
phenotype, by showing that the former strains use CCR5
[19
, 20
, 26
27
28
], a receptor
for CC chemokines RANTES, macrophage inflammatory protein (MIP)-1
,
MIP-1ß, and monocyte chemotactic protein-2 (MCP-2)
[29
30
31
32
], whereas the latter use CXCR4
[18
], a receptor for the CXC chemokine stromal
cell-derived factor 1 (SDF-1) [33
, 34
]. A
new nomenclature for HIV-1 strains was adopted, with isolates that use
CCR5 termed R5 viruses, those using CXCR4 designated X4 viruses, and
viruses able to use both co-receptors (dual-tropic) called R5X4
[35
]. Further co-receptors that support infection of
cell lines in vitro by various but usually a minority of
isolates have also been identified. These include CCR3
[27
, 28
], APJ [36
], CCR2b
[28
], CCR8 [37
38
39
], CX3CR1
[37
], CCR9 [36
], ChemR23
[40
], STRL-33 [41
42
43
], GPR15
[42
, 44
], GPR1 [44
], US28
[45
], and Leukotriene B4 [46
]. CCR5 is
predominantly expressed on macrophages [11
,
47
48
49
], dendritic cells [11
,
50
51
52
], brain microglial cells [53
54
55
],
and memory T cells [56
] but absent on most T cell lines.
CXCR4 is more widely expressed and present on both naive and memory T
cells [56
, 57
] as well as monocytes, and at
lower levels on mature macrophages [58
]. Thus, the
cellular tropism of HIV-1 is largely determined by differential usage
of chemokine receptors. This simple picture, however, has several
exceptions. Hence, some R5 HIV-1 strains do not infect macrophages,
although these cells express high levels of CCR5 [59
,
60
], whereas many primary X4 strains do not replicate in
several cell lines expressing CXCR4 [61
].
Besides env, accessory genes can sometimes interfere with
cell tropism, at least in vitro. For instance,
vpr, vif, and vpu are nonessential
HIV-1 genes that are dispensible for infection and replication in
established cell lines, yet are required to various extents for
replication in primary macrophages and/or peripheral blood mononuclear
cells (PBMCs) [62
63
64
]. Mutations that affect the
function of such genes are probably selected against and rare in
vivo, however, may accrue during passage in T cell lines in
vitro.
Here we review our recent studies assessing the adaptation of primary
R5 strains for replication in T cell lines, the effects on co-receptor
use, and the resulting effects on envelope and accessory genes.
INFECTION OF CD4+ T CELL LINES VIA LOW LEVELS OF CCR5
The majority of CCR5-using viruses do not infect CD4+
T cell lines, however, some R5 strains can infect two T cell lines,
Molt4 and SupT1 [65
]. These strains include a
molecularly cloned variant virus, HIV-1C3 that was derived
from HIV1JR-CSF. HIV-1C3 was adapted
in vitro for replication in Molt4 cells after multiple
passages. Sequencing revealed that a single amino acid change in the V1
loop accounted for HIV-1C3s extended tropism for both
Molt4 and SupT1 cells. Thus, if the V3 loop on gp120 is a major
determinant of both cell tropism [66
67
68
69
70
71
72
73
74
] and more
recently of co-receptor usage [75
76
77
], other envelope
elements are also involved [77
78
79
80
81
]. Several reports
have implicated the V1/V2 loops of gp120 [65
,
82
83
84
85
86
87
]. The V1/V2 domains, in addition to the required
V3 domain, influence the efficiency of replication of HIV-1 in primary
macrophages [68
, 85
, 88
] and
in Jurkat T cells [86
]. Groenink et al.
[84
] described the configuration of a hypervariable
locus in the V2 domain that appeared to be predictive for a switch from
an NSI to an SI phenotype. V1/V2 sequences act in conjunction with a
CCR5 tropic V3 loop to confer CCR3 usage to some NSI strains
[87
]. Kwong et al. [89
] have recently
reported the crystal structure of gp120 complexed with CD4 and a
neutralizing antibody. This structure shows that the stems of the V1/V2
loops and V3 loop are located, respectively, on inner and outer domains
of gp120 and on either side of a bridging sheet that spans these two
domains. The co-receptor binding site is thought to contain amino acids
in this bridging sheet and probably residues in the V3 loop. In some
circumstances, the V1/V2 loops are dispensible for high-affinity
binding to co-receptors [90
] and viral replication
[86
], yet when present on gp120 they can have a profound
influence on tropism and co-receptor use.
We showed that, in addition to HIV-1C3, of 10 R5 viruses
tested, two further strains (HIV-1BR92 and
HIV-1E80) consistently replicated in Molt4 and SupT1,
providing evidence that viruses like the HIV-1C3 variant do
exist in vivo (Table 1
) [91
]. These strains had only been passaged in
PBMCs and did not replicate in other T cell lines tested. For one
isolate (HIV-1ADA) that failed to infect either Molt4 or
SupT1, we prepared pseudotype virus that carried the vesicular
stomatitis virus envelope glycoprotein G. This pseudotype efficiently
infected both Molt4 and SupT1, thus indicating that the block to
infection occurred early in the replication and could be bypassed by
virions carrying foreign envelope glycoprotein.
The three Molt4/SupT1-tropic viruses used CCR5 predominantly
on
CD4
+ cell lines
(Table 1)
and did not replicate in
CCR5-negative
PBMCs derived from individuals homozygous for

32 CCR5.
They
did not use CXCR4, nor was any alternative receptor (CCR8, GPR-15,
STRL-33,
GPR-1, CX3CR1, D6, CCR1, CCR2b, CCR3) used consistently,
although
low-level infection via CCR3, STRL-33, GPR-15, and CCR8 was
noted
occasionally. Infection of Molt4 and SupT1 by each of these
three
strains was potently inhibited by ligands for CCR5 (AOP-RANTES,
RANTES,
and MIP-1ß) and by a monoclonal antibody specific
for CCR5 (2D7;
Fig. 1
). No block of HIV replication was observed
using ligands to other
co-receptors, e.g., eotaxin (CCR3) and
AMD3100 (CXCR4). CCR5 mRNA was
present in both Molt4 and SupT1
by reverse transcriptase-polymerase
chain reaction (RT-PCR),
although CCR5 protein could not be detected on
either the cell
surface or in intracellular vesicles through the use of
either
FACScan or confocal microscopy. The expanded tropism of the
three
strains was therefore not due to adaptation to a new co-receptor
but
most probably due to their capacity to exploit extremely low
levels
of CCR5 on Molt4 and SupT1 cells. This could be further
tested by using
a cell line expressing various amounts of CCR5,
such as the one
developed by Platt et al. [
92
].
The capacity of R5 strains to use low levels of CCR5 could have
important
significance
in vivo by allowing viruses to infect
new cell
populations and spreading the infection to new body
compartments.
Adaptation for one cell type, however, may compromise
infectivity
for others. Like other R5 isolates, HIV-1
E80
replicates efficiently
in primary macrophages but has consistently
failed to infect
fetal brain cell cultures containing CCR5
+
microglia [
93
].
We are currently assessing whether other
Molt4/SupT1 tropic
strains (HIV-1
C3 and
HIV-1
BR92) also have a reduced capacity
to infect brain
microglia.

ADAPTATION OF AN R5 STRAIN TO USE CXCR4 AND INFLUENCE ON
REPLICATION IN MACROPHAGES
HIV-1
SF162 variants that replicated in C8166 cells
emerged after
only a few passages after infection. C8166 cells do not
express
CCR5 and replicating virus was associated with the production
of
large syncytia. Two HIV-1
SF162 variants were isolated
that efficiently
infected C8166. One variant retained the ability to
infect macrophages
and PBMCs, similar to wild-type
HIV-1
SF162 and was therefore
dual-tropic. The second
variant became T cell line tropic and
replicated poorly in both
macrophages and PBMCs (
Fig. 2
).
Sequence analysis revealed that both T- and dual-tropic variants
had
two common amino acid substitutions in the V3 loop (IGPGRA
to RGPGRV).
One of these (I to R) increased the overall positive
charge of the V3
loop, a property associated with an SI phenotype
and CXCR4 use. Few
other amino-acid changes were observed outside
the variable regions of
env, mostly common to both strains.
A single base mutation
in the translation initiation codon of
vpu (ATG to ATA) was
also noted for T-tropic variant, whereas
the wild-type and dual-tropic
strains retained the ATG codon.
C8166 infection was associated with the
capacity of the two
variants to use CXCR4 as well as CCR5. A role for
other co-receptors
was not implicated. Chimeric molecular clones were
constructed
to ascertain the role of the envelope and
vpu
mutations in the
loss of macrophage tropism. Complete envelope genes
derived
from either the dual-tropic or T-tropic variants conferred
macrophage
infection, whereas loss of macrophage infection was
determined
entirely by a single mutation in
vpu [N. Dejucq
et al., unpublished
observations].
In vivo, co-receptor switching for R5 strains to CXCR4 use
is apparently rare, with only about half of AIDS patients carrying SI
strains. The pressures in vivo that select against CXCR4 use
are currently unclear, although immune (neutralizing antibodies)
[94
] and non-immune (SDF-1) mechanisms
[95
] have been suggested. Whatever the selective
pressure, it appears to wane late in disease when X4 strains emerge and
persist. In vivo, CXCR4 use is associated with acquisition
of positively charged amino acids at one (or both) of two specific
sites in the V3 loop (e.g., CTRPNNNTRKRIRIGPGRAFYATGKIIGNIRQAHC). T
cell line-adapted strains, e.g., the 17.11 variant of
HIV-1JR-CSF [96
] often carry positive amino
acids at these sites, however, the HIV-1SF162 variants
described here [N. Dejucq et al., unpublished results] contain an
additional positive amino acid (I to R change) at a distinct site.
Different selection pressures during T cell line adaptation may allow
the V3 loop to adopt subtle conformations in vitro, thus
allowing positive amino acids at alternative sites to confer CXCR4 use.
Cheng-Mayers group have also described an HIV-1SF162
variant selected independently for replication in the HUT78 T cell line
[97
]. Coincidently, Cheng-Mayers variant contained the
same V3 loop amino acid substitutions as our variants, which were shown
to confer CXCR4 use and infectivity for HUT78 [59
].

DISCUSSION
Most primary R5 viruses can readily adapt
in vitro to
use CXCR4
for infection of T cell lines. We suspect that some strains
need
few amino acid substitutions to acquire CXCR4 use because they
rapidly
adapt, whereas others need more extensive passages and must
require
multiple changes. The potential of R5 strains to acquire an
X4
phenotype
in vitro is consistent with the presence of
unidentified
selective pressures that usually prevent CXCR4 use
in vivo until
late in disease. A minority of R5 viruses can,
however, infect
particular T cell lines without adaptation to use
CXCR4. These
strains have the ability to exploit low concentrations of
CCR5,
which confer them an expanded tropism.
The accidental infection of a laboratory worker by the TCLA CXCR4-using
HIV-1 strain, IIIB [98
] has enabled some insight into
the effects of T cell line passage on the in vivo properties
of such viruses. Whereas the parental HIV-1IIIB strain is T
tropic and infects primary macrophages inefficiently, isolates from the
infected worker were macrophage-tropic. Thus, adaptation occurred to
allow the virus to infect new cell targets and become more infectious
in vivo. Six unique amino acid mutations in the V3 loop
region accounted for this increased replication. The change in tropism,
however, was not associated with a switch to CCR5 use because the
isolates continued to use CXCR4 as the sole co-receptor for entry into
PBMCs [99
]. There are no reports on the current health
of this patient to assess the virulence of the HIV-1IIIB
strains.
Mutations in vpu have previously been reported to affect
macrophage [62
, 63
, 100
,
101
] and PBMC replication [63
,
100
]. Vpu has two domains that are responsible for
distinct functions. The amino terminus of Vpu forms a transmembrane
region that has been implicated as an ion channel [102
],
whereas the cytoplasmic carboxy-terminal domain of the protein
interacts CD4 molecules that have formed complexes with viral envelope
glycoproteins. CD4 is then redirected into proteosomes for degradation
[103
]. Both Vpu functions contribute to release of virus
particles from the cell surface [104
]. Accessory genes
such as vpu and vpr are not required for
replication in rapidly dividing T cell lines and thus mutations will
simply accumulate in such genes with multiple rounds of replication.
However, for macrophage replication where virus particles are
predominantly bud into internal vesicles, a defective vpu
may seriously affect cell-to-cell spread of infection. Moreover, there
could be in vivo situations where mutations in accessory
genes may occur and prevail. For instance, when virus is replicating in
T cells that are rapidly dividing after immune activation.
Naturally occurring mutations in the start codon of vpu have
previously been reported [105
, 106
].
Schubert et al. described an HIV-1 isolate (AD8) that has evolved a
mechanism to compensate for the loss of Vpu function. HIV-2 and SIVs do
not have a vpu gene, however, virion release appears to be
controlled by determinants in the envelope glycoprotein. HIV-2 envelope
can thus complement a vpu-defective HIV-1 strain
[107
]. The AD8 envelope appears to function in the same
way, although the mechanisms directed by such envelopes are unclear.
The generation of mutations in accessory genes such as vpu
is unlikely to reflect events in vivo. Viruses that carry
mutations in accessory genes are likely to be attenuated in
vivo [108
, 109
] as shown for SIVmac
strains mutated for the loss of up to three accessory genes
[110
]. Such strains may be candidates as live vaccines
[111
].
Although not reflecting the in vivo situation, in
vitro experiments show that shifts in cell tropism can result from
either envelope change and/or mutations that abrogate accessory gene
functions, and are not necessarily linked to a shift in co-receptor
usage.

ACKNOWLEDGEMENTS
This work was supported partly by an MRC program grant and partly
by
an EU Biomed II grant. We thank Robin Weiss for constructive
criticism
as well as Graham Simmons, Sam Hibbitts, Jackie Reeves, and
Aine
Mc Knight for help and suggestions. We are particularly grateful
to
Paul Clapham for his help in preparing the manuscript and for
his
kind support.

REFERENCES
1
- Goudsmit, J. (1995) The role of viral diversity in HIV pathogenesis J. Acquir. Immune Defic. Syndr. Hum. Retrovirol. 10,S15-S19
2
- Koot, M., van t Wout, A. B., Kootstra, N. A., de Goede, R. E., Tersmette, M., Schuitemaker, H. (1996) Relation between changes in cellular load, evolution of viral phenotype, and the clonal composition of virus populations in the course of human immunodeficiency virus type 1 infection J. Infect. Dis. 173,349-354[Medline]
3
- Richman, D. D. (1994) Resistance, drug failure, and disease progression AIDS Res. Hum. Retroviruses 10,901-905[Medline]
4
- Schuitemaker, H., Koot, M., Kootstra, N. A., Dercksen, M. W., de Goede, R. E., van Steenwijk, R. P., Lange, J. M., Schattenkerk, J. K., Miedema, F., Tersmette, M. (1992) Biological phenotype of human immunodeficiency virus type 1 clones at different stages of infection: progression of disease is associated with a shift from monocytotropic to T-cell-tropic virus population J. Virol. 66,1354-1360[Abstract/Free Full Text]
5
- Tersmette, M., de Goede, R. E., Al, B. J., Winkel, I. N., Gruters, R. A., Cuypers, H. T., Huisman, H. G., Miedema, F. (1988) Differential syncytium-inducing capacity of human immunodeficiency virus isolates: frequent detection of syncytium-inducing isolates in patients with acquired immunodeficiency syndrome (AIDS) and AIDS-related complex J. Virol. 62,2026-2032[Abstract/Free Full Text]
6
- Tersmette, M., Gruters, R. A., de Wolf, F., de Goede, R. E., Lange, J. M., Schellekens, P. T., Goudsmit, J., Huisman, H. G., Miedema, F. (1989) Evidence for a role of virulent human immunodeficiency virus (HIV) variants in the pathogenesis of acquired immunodeficiency syndrome: studies on sequential HIV isolates J. Virol. 63,2118-2125[Abstract/Free Full Text]
7
- Connor, R. I., Mohri, H., Cao, Y., Ho, D. D. (1993) Increased viral burden and cytopathicity correlate temporally with CD4+ T-lymphocyte decline and clinical progression in human immunodeficiency virus type 1-infected individuals J. Virol. 67,1772-1777[Abstract/Free Full Text]
8
- Fenyo, E. M., Morfeldt Manson, L., Chiodi, F., Lind, B., von Gegerfelt, A., Albert, J., Olausson, E., Asjo, B. (1988) Distinct replicative and cytopathic characteristics of human immunodeficiency virus isolates J. Virol. 62,4414-4419[Abstract/Free Full Text]
9
- Valentin, A., Albert, J., Fenyo, E. M., Asjo, B. (1994) Dual tropism for macrophages and lymphocytes is a common feature of primary human immunodeficiency virus type 1 and 2 isolates J. Virol. 68,6684-6689[Abstract/Free Full Text]
10
- Karita, E., Nkengasong, J. N., Willems, B., Vanham, G., Fransen, K., Heyndrickx, L., Janssens, W., Piot, P., van der Groen, G. (1997) Macrophage-tropism of HIV-1 isolates of different genetic subtypes AIDS 11,1303-1304[Medline]
11
- Zaitseva, M., Blauvelt, A., Lee, S., Lapham, C. K., Klaus Kovtun, V., Mostowski, H., Manischewitz, J., Golding, H. (1997) Expression and function of CCR5 and CXCR4 on human Langerhans cells and macrophages: implications for HIV primary infection Nat. Med. 3,1369-1375[Medline]
12
- Yi, Y., Rana, S., Turner, J. D., Gaddis, N., Collman, R. G. (1998) CXCR-4 is expressed by primary macrophages and supports CCR5-independent infection by dual-tropic but not T-tropic isolates of human immunodeficiency virus type 1 J. Virol. 72,772-777[Abstract/Free Full Text]
13
- Fear, W. R., Kesson, A. M., Naif, H., Lynch, G. W., Cunningham, A. L. (1998) Differential tropism and chemokine receptor expression of human immunodeficiency virus type 1 in neonatal monocytes, monocyte-derived macrophages, and placental macrophages J. Virol. 72,1334-1344[Abstract/Free Full Text]
14
- Simmons, G., Wilkinson, D., Reeves, J. D., Dittmar, M. T., Beddows, S., Weber, J., Carnegie, G., Desselberger, U., Gray, P. W., Weiss, R. A., Clapham, P. R. (1996) Dual-tropic, primary, syncytium-inducing HIV-1 strains that can use either Lestr or CCR5 as co-receptors for virus entry J. Virol. 70,8355-8360[Abstract/Free Full Text]
15
- Simmons, G., Reeves, J., McKnight, A., Dejucq, N., Hibbitts, S., Power, C., Aarons, E., Schols, D., de Clercq, E., Proudfoot, A., Clapham, P. (1998) CXCR4 as a functionnal co-receptor for Human Immunodeficiency Virus type 1 infection of primary macrophages J. Virol. 72,8453-8457[Abstract/Free Full Text]
16
- Zhu, T., Mo, H., Wang, N., Nam, D. S., Cao, Y., Koup, R. A., Ho, D. D. (1993) Genotypic and phenotypic characterization of HIV-1 patients with primary infection Science 261,1179-1181
17
- Koot, M., Keet, I. P., Vos, A. H., de Goede, R. E., Roos, M. T., Coutinho, R. A., Miedema, F., Schellekens, P. T., Tersmette, M. (1993) Prognostic value of HIV-1 syncytium-inducing phenotype for rate of CD4+ cell depletion and progression to AIDS Ann. Intern. Med. 118,681-688[Abstract/Free Full Text]
18
- Feng, Y., Broder, C. C., Kennedy, P. E., Berger, E. A. (1996) HIV-1 entry cofactor: functional cDNA cloning of a seven-transmembrane G-protein coupled receptor Science 272,872-877[Abstract]
19
- Dragic, T., Litwin, V., Allaway, G., Martin, S. R., Huang, Y., Nagashima, K. A., Cayanan, C., Maddon, P. J., Koup, R. A., Moore, J. P., Paxton, W. A. (1996) HIV-1 entry into CD4+ cells is mediated by the chemokine receptor CC-CKR5 Nature 381,667-673[Medline]
20
- Deng, H., Liu, R., Elmeier, W., Choe, S., Unutmaz, D., Burkhart, M., Di Marzio, P., Marmon, S., Sutton, R. E., Hill, C. M., Davis, C. B., Peiper, S. C., Schall, T. J., Littman, D. R., Landau, N. R. (1996) Identification of a major co-receptor for primary isolates of HIV-1 Nature 381,661-666[Medline]
21
- Berger, E. A. (1997) HIV entry and tropism: the chemokine receptor connection AIDS 11,S3-S16
22
- Moore, J. P. (1997) Coreceptors: implications for HIV pathogenesis and therapy Science 276,51-52[Free Full Text]
23
- Clapham, P. R., Weiss, R. A. (1997) Immunodeficiency viruses. Spoilt for choice of co-receptors Nature 388,230-231[Medline]
24
- Doranz, B. J., Berson, J. F., Rucker, J., Doms, R. W. (1997) Chemokine receptors as fusion cofactors for human immunodeficiency virus type 1 (HIV-1) Immunol. Res. 16,15-28[Medline]
25
- Zhang, L., Huang, Y., He, T., Cao, Y., Ho, D. D. (1996) HIV-1 subtype and second-receptor use Nature 383,768[Medline]
26
- Alkhatib, G., Combadiere, C., Broder, C. C., Feng, Y., Kennedy, P. E., Murphy, P. M., Berger, E. A. (1996) CC CKR5: a RANTES, MIP-1
, MIP-1ß receptor as fusion cofactor for macrophage-tropic HIV-1 Science 272,1955-1958[Abstract]
27
- Choe, H., Farzan, M., Sun, Y., Sullivan, N., Rollins, B., Ponath, P. D., Wu, L., Mackay, C. R., LaRosa, G., Newman, W., Gerard, N., Gerard, C., Sodroski, J. (1996) The beta-chemokine receptors CCR3 and CCR5 facilitate infection by primary HIV-1 isolates Cell 85,1135-1148[Medline]
28
- Doranz, B. J., Rucker, J., Yi, Y., Smyth, R. J., Samson, M., Peiper, S. C., Parmentier, M., Collman, R. G., Doms, R. W. (1996) A dual-tropic primary HIV-1 isolate that uses fusin and the beta-chemokine receptors CKR-5, CKR-3, and CKR-2b as fusion cofactors Cell 85,1149-1158[Medline]
29
- Combadiere, C., Ahuja, S. K., Tiffany, H. L., Murphy, P. M. (1996) Cloning and functional expression of CC CKR5, a human monocyte CC chemokine receptor selective for MIP-1(alpha), MIP-1(beta), and RANTES J. Leukoc. Biol. 60,147-152[Abstract]
30
- Raport, C. J., Gosling, J., Schweickart, V. L., Gray, P. W., Charo, I. F. (1996) Molecular cloning and functional characterization of a novel human CC chemokine receptor (CCR5) for RANTES, MIP-1
, and MIP-1ß J. Biol. Chem. 271,17161-17166[Abstract/Free Full Text]
31
- Samson, M., Labbe, O., Mollereau, C., Vassart, G., Parmentier, M. (1996) Molecular cloning and functional expression of a new human CC-chemokine receptor gene Biochemistry 11,3362-3367
32
- Gong, W., Howard, O. M., Turpin, J. A., Grimm, M. C., Ueda, H., Gray, P. W., Raport, C. J., Oppenheim, J. J., Wang, J. M. (1998) Monocyte chemotactic protein-2 activates CCR5 and blocks CD4/CCR5-mediated HIV-1 entry/replication J. Biol. Chem. 273,4289-4292[Abstract/Free Full Text]
33
- Bleul, C. C., Farzan, M., Choe, H., Parolin, C., Clark-Lewis, I., Sodroski, J., Springer, T. A. (1996) The lymphocyte chemoattractant SDF-1 is a ligand for LESTR/fusin and blocks HIV-1 entry Nature 382,829-833[Medline]
34
- Oberlin, E., Amara, A., Bachelerie, F., Bessia, C., Virelizier, J.-L., Arenzana-Seisdedos, F., Schwartz, O., Heard, J.-M., Clark-Lewis, I., Legler, D. F., Loetscher, M., Baggiolini, M., Moser, B. (1996) The CXC chemokine SDF-1 is the ligand for LESTR/fusin and prevents infection by T-cell-line-adapted HIV-1 Nature 382,833-835[Medline]
35
- Berger, E. A., Doms, R. W., Fenyo, E. M., Korber, B. T., Littman, D. R., Moore, J. P., Sattentau, Q. J., Schuitemaker, H., Sodroski, J., Weiss, R. A. (1998) A new classification for HIV-1 Nature 391,240[Medline]
36
- Choe, H., Farzan, M., Konkel, M., Martin, K., Sun, Y., Marcon, L., Cayabyab, M., Berman, M., Dorf, M. E., Gerard, N., Gerard, C., Sodroski, J. (1998) The orphan seven-transmembrane receptor apj supports the entry of primary T-cell-line-tropic and dual-tropic human immunodeficiency virus type 1 J. Virol. 72,6113-6118[Abstract/Free Full Text]
37
- Rucker, J., Edinger, A. L., Sharron, M., Samson, M., Lee, B., Berson, J. F., Yi, Y., Margulies, B., Collman, R. G., Doranz, B. J., Parmentier, M., Doms, R. W. (1997) Utilization of chemokine receptors, orphan receptors, and herpesvirus-encoded receptors by diverse human and simian immunodeficiency viruses J. Virol. 71,8999-9007[Abstract/Free Full Text]
38
- Jinno, A., Shimizu, N., Soda, Y., Haraguchi, Y., Kitamura, T., Hoshino, H. (1998) Identification of the chemokine receptor TER1/CCR8 expressed in brain-derived cells and T cells as a new coreceptor for HIV-1 infection Biochem. Biophys. Res. Commun. 243,497-502[Medline]
39
- Horuk, R. (1998) Chemokines beyond inflammation Nature 393,524-525[Medline]
40
- Samson, M., Edinger, A. L., Stordeur, P., Rucker, J., Verhasselt, V., Sharron, M., Govaerts, C., Mollereau, C., Vassart, G., Doms, R. W., Parmentier, M. (1998) ChemR23, a putative chemoattractant receptor, is expressed in monocyte-derived dendritic cells and macrophages and is a coreceptor for SIV and some primary HIV-1 strains Eur. J. Immunol. 28,1689-1700[Medline]
41
- Alkhatib, G., Liao, F., Berger, E. A., Farber, J. M., Peden, K. W. (1997) A new SIV co-receptor, STRL33 Nature 388,238[Medline]
42
- Deng, H. K., Unutmaz, D., KewalRamani, V. N., Littman, D. R. (1997) Expression cloning of new receptors used by simian and human immunodeficiency viruses Nature 388,296-300[Medline]
43
- Loetscher, M., Amara, A., Oberlin, E., Brass, N., Legler, D., Loetscher, P., DApuzzo, M., Meese, E., Rousset, D., Virelizier, J. L., Baggiolini, M., Arenzana Seisdedos, F., Moser, B. (1997) TYMSTR, a putative chemokine receptor selectively expressed in activated T cells, exhibits HIV-1 coreceptor function Curr. Biol. 7,652-660[Medline]
44
- Farzan, M., Choe, H., Martin, K., Marcon, L., Hofmann, W., Karlsson, G., Sun, Y., Barrett, P., Marchand, N., Sullivan, N., Gerard, N., Gerard, C., Sodroski, J. (1997) Two orphan seven-transmembrane segment receptors which are expressed in CD4-positive cells support simian immunodeficiency virus infection J. Exp. Med. 186,405-411[Abstract/Free Full Text]
45
- Pleskoff, O., Treboute, C., Brelot, A., Heveker, N., Seman, M., Alizon, M. (1997) Identification of a chemokine receptor encoded by human cytomegalovirus as a cofactor for HIV-1 entry Science 276,1874-1878[Abstract/Free Full Text]
46
- Owman, C., Garzino-Demo, A., Cocchi, F., Popovic, M., Sabirsh, A., Gallo, R. C. (1998) The leukotriene B4 receptor functions as a novel type of coreceptor mediating entry of primary HIV-1 isolates into CD4-positive cells Proc. Natl. Acad. Sci. USA 95,9530-9534[Abstract/Free Full Text]
47
- Rana, S., Besson, G., Cook, D. G., Rucker, J., Smyth, R. J., Yi, Y., Turner, J. D., Guo, H. H., Du, J. G., Peiper, S. C., Lavi, E., Samson, M., Libert, F., Liesnard, C., Vassart, G., Doms, R. W., Parmentier, M., Collman, R. G. (1997) Role of CCR5 in infection of primary macrophages and lymphocytes by macrophage-tropic strains of human immunodeficiency virus: resistance to patient-derived and prototype isolates resulting from the delta ccr5 mutation J. Virol. 71,3219-3227[Abstract/Free Full Text]
48
- Tuttle, D. L., Harrison, J. K., Anders, C., Sleasman, J. W., Goodenow, M. M. (1998) Expression of CCR5 increases during monocyte differentiation and directly mediates macrophage susceptibility to infection by human immunodeficiency virus type 1 J. Virol. 72,4962-4969[Abstract/Free Full Text]
49
- Wu, L., Paxton, W. A., Kassam, N., Ruffing, N., Rottman, J. B., Sullivan, N., Choe, H., Sodroski, J., Newman, W., Koup, R. A., Mackay, C. R. (1997) CCR5 levels and expression pattern correlate with infectability by macrophage-tropic HIV-1, in vitro J. Exp. Med. 185,1681-1691[Abstract/Free Full Text]
50
- Granelli Piperno, A., Moser, B., Pope, M., Chen, D., Wei, Y., Isdell, F., ODoherty, U., Paxton, W., Koup, R., Mojsov, S., Bhardwaj, N., Clark Lewis, I., Baggiolini, M., Steinman, R. M. (1996) Efficient interaction of HIV-1 with purified dendritic cells via multiple chemokine coreceptors J. Exp. Med. 184,2433-2438[Abstract/Free Full Text]
51
- Blauvelt, A., Asada, H., Saville, M. W., Klaus Kovtun, V., Altman, D. J., Yarchoan, R., Katz, S. I. (1997) Productive infection of dendritic cells by HIV-1 and their ability to capture virus are mediated through separate pathways J. Clin. Invest. 100,2043-2053[Medline]
52
- Ayehunie, S., Garcia Zepeda, E. A., Hoxie, J. A., Horuk, R., Kupper, T. S., Luster, A. D., Ruprecht, R. M. (1997) Human immunodeficiency virus-1 entry into purified blood dendritic cells through CC and CXC chemokine coreceptors Blood 90,1379-1386[Abstract/Free Full Text]
53
- He, J., Chen, Y., Farzan, M., Choe, H., Ohagen, A., Gartner, S., Busciglio, J., Yang, X., Hofmann, W., Newman, W., Mackay, C. R., Sodroski, J., Gabuzda, D. (1997) CCR3 and CCR5 are co-receptors for HIV-1 infection of microglia Nature 385,645-649[Medline]
54
- Ghorpade, A., Xia, M. Q., Hyman, B. T., Persidsky, Y., Nukuna, A., Bock, P., Che, M., Limoges, J., Gendelman, H. E., Mackay, C. R. (1998) Role of the beta-chemokine receptors CCR3 and CCR5 in human immunodeficiency virus type 1 infection of monocytes and microglia J. Virol. 72,3351-3361[Abstract/Free Full Text]
55
- Shieh, J. T., Albright, A. V., Sharron, M., Gartner, S., Strizki, J., Doms, R. W., Gonzalez Scarano, F. (1998) Chemokine receptor utilization by human immunodeficiency virus type 1 isolates that replicate in microglia J. Virol. 72,4243-4249[Abstract/Free Full Text]
56
- Bleul, C. C., Wu, L., Hoxie, J. A., Springer, T. A., Mackay, C. R. (1997) The HIV coreceptors CXCR4 and CCR5 are differentially expressed and regulated on human T lymphocytes Proc. Natl. Acad. Sci. USA 94,1925-1930[Abstract/Free Full Text]
57
- Mo, H., Monard, S., Pollack, H., Ip, J., Rochford, G., Wu, L., Hoxie, J., Borkowsky, W., Ho, D. D., Moore, J. P. (1998) Expression patterns of the HIV type 1 coreceptors CCR5 and CXCR4 on CD4+ T cells and monocytes from cord and adult blood AIDS. Res. Hum. Retroviruses 14,607-617[Medline]
58
- McKnight, Á, Wilkinson, D., Simmons, G., Talbot, S., Picard, L., Ahuja, M., Hoxie, J. A., Clapham, P. R. (1997) Inhibition of HIV fusion by a monoclonal antibody to a co-receptor (CXCR4) is both cell type and virus strain dependent J. Virol. 71,1662-1696[Abstract/Free Full Text]
59
- Cheng Mayer, C., Liu, R., Landau, N. R., Stamatatos, L. (1997) Macrophage tropism of human immunodeficiency virus type 1 and utilization of the CC-CKR5 coreceptor J. Virol. 71,1657-1661[Abstract/Free Full Text]
60
- Dittmar, M. T., McKnight, Á, Simmons, G., Clapham, P. R., Weiss, R. A., Simmonds, P. (1997) HIV-1 tropism and co-receptor usage Nature 385,495-496[Medline]
61
- Kozak, S. L., Platt, E. J., Madani, N., Ferro, F. E., Jr, Peden, K., Kabat, D. (1997) CD4, CXCR-4, and CCR-5 dependencies for infections by primary patient and laboratory-adapted isolates of human immunodeficiency virus type 1 J. Virol. 71,873-882[Abstract/Free Full Text]
62
- Balliet, J. W., Kolson, D. L., Eiger, G., Kim, F. M., McGaan, K. A., Srinivasan, A., Collman, R. (1994) Distinct effects in primary macrophages and lymphocytes of the human immunodeficiency virus type 1 accessory genes vpr, vpu and nef Virology 200,623-631[Medline]
63
- Kawamura, M., Ishizaki, T., Ishimoto, A., Shioda, T., Kitamura, T., Adachi, A. (1994) Growth ability of human immunodeficiency virus type 1 auxiliary gene mutants in primary blood macrophage cultures J. Gen. Virol. 75,2427-2431[Abstract/Free Full Text]
64
- Gabuzda, D., He, J., Ohagen, A., Vallat, A. V. (1998) Chemokine receptors in HIV-1 infection of the central nervous system Semin. Immunol. 10,203-213[Medline]
65
- Boyd, M. T., Simpson, G. R., Cann, A. J., Johnson, M. A., Weiss, R. A. (1993) A single amino acid substitution in the V1 loop of human immunodeficiency virus type 1 gp120 alters cellular tropism J. Virol. 67,3649-3652[Abstract/Free Full Text]
66
- Hwang, S. R., Boyle, T. J., Lyerly, K., Cullen, B. R. (1992) Identification of the envelope V3 loop as the primary determinant of cell tropism in HIV-1 Science 253,71-74
67
- Chesebro, B., Nishio, J., Perryman, S., Cann, A., OBrien, W. A., Koyanagi, Y., Chen, I. S. Y., Wehrly, K. (1991) Identification of human immunodeficiency virus envelope gene sequences influencing viral entry into CD4-positive HeLa cells, T-leukemia cells, and macrophages J. Virol. 65,5782-5789[Abstract/Free Full Text]
68
- Westervelt, P., Gendelman, H. E., Ratner, L. (1991) Identification of a determinant within the human immunodeficiency virus 1 surface envelope glycoprotein critical for productive infection of primary monocytes Proc. Natl. Acad. Sci. USA 88,3097-3101[Abstract/Free Full Text]
69
- Shioda, T., Levy, J. A., Cheng-Mayer, C. (1991) Macrophage and T-cell line tropisms of HIV-1 are determined by specific regions of the envelope gp120 gene Nature 349,167-169[Medline]
70
- Sharpless, N. E., OBrien, W. A., Verdin, E., Kufta, C. V., Chen, I. S. Y., Dubois-Dalcq, M. (1992) Human immunodeficiency virus type 1 tropism for brain microglial cells is determined by a region of the env glycoprotein that also controls macrophage tropism J. Virol. 66,2588-2593[Abstract/Free Full Text]
71
- Mammano, F., Salvatori, F., Ometto, L., Panozzo, M., Chieco Bianchi, L., De Rossi, A. (1995) Relationship between the V3 loop and the phenotypes of human immunodeficiency virus type 1 (HIV-1) isolates from children perinatally infected with HIV-1 J. Virol. 69,82-92[Abstract/Free Full Text]
72
- Bhattacharyya, D., Brooks, B. R., Callahan, L. (1996) Positioning of positively charged residues in the V3 loop correlates with HIV type 1 syncytium-inducing phenotype AIDS Res. Hum. Retroviruses 12,83-90[Medline]
73
- Chesebro, B., Wehrly, K., Nishio, J., Perryman, S. (1996) Mapping of independent V3 envelope determinants of human immunodeficiency virus type 1 macrophage tropism and syncytium formation in lymphocytes J. Virol. 70,9055-9059[Abstract/Free Full Text]
74
- Trujillo, J. R., Wang, W. K., Lee, T. H., Essex, M. (1996) Identification of the envelope V3 loop as a determinant of a CD4-negative neuronal cell tropism for HIV-1 Virology 217,613-617[Medline]
75
- Speck, R. F., Wehrly, K., Platt, E. J., Atchison, R. E., Charo, I. F., Kabat, D., Chesebro, B., Goldsmith, M. A. (1997) Selective employment of chemokine receptors as human immunodeficiency virus type 1 coreceptors determined by individual amino acids within the envelope V3 loop J. Virol. 71,7136-7139[Abstract/Free Full Text]
76
- Xiao, L., Owen, S. M., Goldman, I., Lal, A. A., deJong, J. J., Goudsmit, J., Lal, R. B. (1998) CCR5 coreceptor usage of non-syncytium-inducing primary HIV-1 is independent of phylogenetically distinct global HIV-1 isolates: delineation of consensus motif in the V3 domain that predicts CCR-5 usage Virology 240,83-92[Medline]
77
- Rizzuto, C. D., Wyatt, R., Hernandez Ramos, N., Sun, Y., Kwong, P. D., Hendrickson, W. A., Sodroski, J. (1998) A conserved HIV gp120 glycoprotein structure involved in chemokine receptor binding Science 280,1949-1953[Abstract/Free Full Text]
78
- Kim, F. M., Kolson, D. L., Balliet, J. W., Srinivasan, A., Collman, R. G. (1995) V3-independent determinants of macrophage tropism in a primary human immunodeficiency virus type 1 isolate J. Virol. 69,1755-1761[Abstract/Free Full Text]
79
- Trkola, A., Dragic, T., Arthos, J., Binley, J. M., Olson, W. C., Allaway, G. P., Cheng-Meyer, C., Robinson, J., Maddon, P. J., Moore, J. P. (1996) CD4-dependent, antibody-sensitive interactions between HIV-1 and its co-receptor CCR-5 Nature 384,184-187[Medline]
80
- Bieniasz, P. D., Fridell, R. A., Aramori, I., Ferguson, S. S. G., Caron, M. G., Cullen, B. R. (1997) HIV-1 induced cell fusion is mediated by multiple regions within both the viral envelope and the CCR-5 co-receptor EMBO J 16,2599-2609[Medline]
81
- Reeves, J. D., Schulz, T. F. (1997) The CD4-independent tropism of human immunodeficiency virus type 2 involves several regions of the envelope protein and correlates with a reduced activation threshold for envelope-mediated fusion J. Virol. 71,1453-1465[Abstract/Free Full Text]
82
- Andeweg, A. C., Leeflang, P., Osterhaus, A. D., Bosch, M. L. (1993) Both the V2 and V3 regions of the human immunodeficiency virus type 1 surface glycoprotein functionally interact with other envelope regions in syncytium formation J. Virol. 67,3232-3239[Abstract/Free Full Text]
83
- Sullivan, N., Thali, M., Furman, C., Ho, D. D., Sodroski, J. (1993) Effects of amino acid changes in the V2 region of the human immunodeficiency virus type 1 gp120 glycoprotein on subunit association, syncytium formation and recognition by neutralizing antibody J. Virol. 67,3674-3679[Abstract/Free Full Text]
84
- Groenik, M., Fouchier, R. A. M., Broersen, S., Baker, C. H., Koot, M., vant Wout, A. B., Huisman, H. G., Miedema, F., Tersmette, M., Schuitemaker, H. (1993) Relation of phenotype evolution of HIV-1 to envelope V2 configuration Science 260,1513-1515[Abstract/Free Full Text]
85
- Koito, A., Harrowe, G., Levy, J. A., Cheng-Mayer, C. (1994) Functional role of the V1/V2 region of human immunodeficiency virus type 1 envelope glycoprotein gp120 in infection of primary macrophages and soluble CD4 neutralization J. Virol. 68,2253-2259[Abstract/Free Full Text]
86
- Cao, J., Sullivan, N., Desjardin, E., Parolin, C., Robinson, J., Wyatt, R., Sodroski, J. (1997) Replication and neutralization of human immunodeficiency virus type 1 lacking the V1 and V2 variable loops of the gp120 envelope glycoprotein J. Virol. 71,9808-9812[Abstract/Free Full Text]
87
- Ross, T. M., Cullen, B. R. (1998) The ability of HIV type 1 to use CCR-3 as a coreceptor is controlled by envelope V1/V2 sequences acting in conjunction with a CCR-5 tropic V3 loop Proc. Natl. Acad. Sci. USA 95,7682-7686[Abstract/Free Full Text]
88
- Shioda, T., Levy, J. A., Cheng Mayer, C. (1992) Small amino acid changes in the V3 hypervariable region of gp120 can affect the T-cell-line and macrophage tropism of human immunodeficiency virus type 1 Proc. Natl. Acad. Sci. USA 89,9434-9438[Abstract/Free Full Text]
89
- Kwong, P. D., Wyatt, R., Robinson, J., Sweet, R. W., Sodroski, J., Hendrickson, W. A. (1998) Structure of an HIV gp120 envelope glycoprotein in complex with the CD4 receptor and a neutralizing human antibody Nature 393,648-659[Medline]
90
- Wu, L., Gerard, N. P., Wyatt, R., Choe, H., Parolin, C., Ruffing, N., Borsetti, A., Cardoso, A. A., Desjardin, E., Newman, W., Gerard, C., Sodroski, J. (1996) CD4-induced interaction of primary HIV-1 gp120 glycoproteins with the chemokine receptor CCR-5 Nature 384,179-183[Medline]
91
- Dejucq, N., Simmons, G., Clapham, P. R. (1999) Expanded tropism of primary human immunodeficiency virus type 1 R5 strains to CD4(+) T-cell lines determined by the capacity to exploit low concentrations of CCR5 J. Virol. 73,7842-7847[Abstract/Free Full Text]
92
- Platt, E. J., Wehrly, K., Kuhmann, S. E., Chesebro, B., Kabat, D. (1998) Effects of CCR5 and CD4 cell surface concentrations on infections by macrophage-tropic isolates of human immunodeficiency virus type 1 J. Virol. 72,2855-2864[Abstract/Free Full Text]
93
- Hibbitts, S., Reeves, J. D., Simmons, G., Gray, P. W., Epstein, L. G., Schols, D., de Clercq, E., Wells, T. N., Proudfoot, A. E., Clapham, P. R. (1999) Coreceptor ligand inhibition of fetal brain cell infection by HIV type 1 AIDS Res. Hum. Retroviruses 15,989-1000[Medline]
94
- Lathey, J. L., Pratt, R. D., Spector, S. A. (1997) Appearance of autologous neutralizing antibody correlates with reduction in virus load and phenotype switch during primary infection with human immunodeficiency virus type 1 J. Infect. Dis. 175,231-232[Medline]
95
- Fauci, A. S. (1996) Host factors and the pathogenesis of HIV-induced disease Nature 384,529-534[Medline]
96
- Klasse, P. J., Boyd, M. T., Weiss, R. A., Schulz, T. F. (1996) Mutations in the vpu, env, and nef genes of a syncytium-inducing variant of HIV type 1 JR-CSF that infects a range of T cell lines AIDS Res. Hum. Retroviruses 12,347-350[Medline]
97
- Harrowe, G., Cheng-Mayer, C. (1995) Amino acid substitutions in the V3 loop are responsible for adaptation to growth in transformed T-cell lines of a primary human immunodeficiency virus type 1 Virology 210,490-494[Medline]
98
- Weiss, S. H., Goedert, J. J., Gartner, S., Popovic, M., Waters, D., Markham, P., di Marzo Veronese, F., Gail, M. H., Barkley, W. E., Gibbons, J., et al (1988) Risk of human immunodeficiency virus (HIV-1) infection among laboratory workers Science 239,68-71[Abstract/Free Full Text]
99
- Miller, E., Duus, K., Su, L. (2000) In vivo selected HIV-1 isolate shows altered tropism without shift in co-receptor use. In 7th Conference on Retroviruses and Opportunistic Infections, San Francisco. Abstract 413.
100
- Schubert, U., Clouse, K. A., Strebel, K. (1995) Augmentation of virus secretion by the human immunodeficiency virus type 1 Vpu protein is cell type independent and occurs in cultured human primary macrophages and lymphocytes J. Virol. 69,7699-7711[Abstract/Free Full Text]
101
- Westervelt, P., Henkel, T., Trowbridge, D. B., Orenstein, J., Heuser, J., Gendelman, H. E., Ratner, L. (1992) Dual regulation of silent and productive infection in monocytes by distinct human immunodeficiency virus type 1 determinants J. Virol. 66,3925-3931[Abstract/Free Full Text]
102
- Schubert, U., Ferrer-Montiel, A. V., Oblatt-Montal, M., Henklein, P., Strebel, K., Montal, M. (1996) Identification of an ion channel activity of the Vpu transmembrane domain and its involvement in the regulation of virus release from HIV-1-infected cells FEBS Lett 398,12-18[Medline]
103
- Schubert, U., Anton, L. C., Bacik, I., Cox, J. H., Bour, S., Bennink, J. R., Orlowski, M., Strebel, K., Yewdell, J. W. (1998) CD4 glycoprotein degradation induced by human immunodeficiency virus type 1 Vpu protein requires the function of proteasomes and the ubiquitin-conjugating pathway J. Virol. 72,2280-2288[Abstract/Free Full Text]
104
- Lama, J., Mangasarian, A., Trono, D. (1999) Cell-surface expression of CD4 reduces HIV-1 infectivity by blocking Env incorporation in a Nef- and Vpu-inhibitable manner Curr. Biol. 9,622-631[Medline]
105
- Iwatani, Y., Song, S. K., Wang, L., Planas, J., Sakai, H., Ishimoto, A., Cloyd, M. W. (1997) Human immunodeficiency virus type 1 Vpu modifies viral cytopathic effect through augmented virus release J. Gen. Virol. 78,841-846[Abstract]
106
- Schubert, U., Bour, S., Willey, R. L., Strebel, K. (1999) Regulation of virus release by the macrophage-tropic human immunodeficiency virus type 1 AD8 isolate is redundant and can be controlled by either Vpu or Env J. Virol. 73,887-896[Abstract/Free Full Text]
107
- Bour, S., Schubert, U., Peden, K., Strebel, K. (1996) The envelope glycoprotein of human immunodeficiency virus type 2 enhances viral particle release: a Vpu-like factor? J. Virol. 70,820-829[Abstract/Free Full Text]
108
- Dyer, W. B., Ogg, G. S., Demoitie, M. A., Jin, X., Geczy, A. F., Rowland-Jones, S. L., McMichael, A. J., Nixon, D. F., Sullivan, J. S. (1999) Strong human immunodeficiency virus (HIV)-specific cytotoxic T-lymphocyte activity in Sydney Blood Bank Cohort patients infected with nef-defective HIV type 1 J. Virol. 73,436-443[Abstract/Free Full Text]
109
- Learmont, J. C., Geczy, A. F., Mills, J., Ashton, L. J., Raynes-Greenow, C. H., Garsia, R. J., Dyer, W. B., McIntyre, L., Oelrichs, R. B., Rhodes, D. I., Deacon, N. J., Sullivan, J. S. (1999) Immunologic and virologic status after 14 to 18 years of infection with an attenuated strain of HIV-1. A report from the Sydney Blood Bank Cohort N. Engl. J. Med. 340,1715-1722[Abstract/Free Full Text]
110
- Desrosiers, R. C., Lifson, J. D., Gibbs, J. S., Czajak, S. C., Howe, A. Y., Arthur, L. O., Johnson, R. P. (1998) Identification of highly attenuated mutants of simian immunodeficiency virus J. Virol. 72,1431-1437[Abstract/Free Full Text]
111
- Wyand, M. S., Manson, K., Montefiori, D. C., Lifson, J. D., Johnson, R. P., Desrosiers, R. C. (1999) Protection by live, attenuated simian immunodeficiency virus against heterologous challenge J. Virol. 73,8356-8363[Abstract/Free Full Text]
This article has been cited by other articles:

|
 |

|
 |
 
L. J. Montaner, C.-F. Perno, and S. Crowe
Macrophage infection by HIV-1: focus on viral reservoirs and pathogenesis
J. Leukoc. Biol.,
September 1, 2000;
68(3):
301 - 302.
[Full Text]
[PDF]
|
 |
|