Pepro Tech

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF) Free
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Dejucq, N.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Dejucq, N.
(Journal of Leukocyte Biology. 2000;68:331-337.)
© 2000 by Society for Leukocyte Biology

HIV-1 replication in CD4+ T cell lines: the effects of adaptation on co-receptor use, tropism, and accessory gene function

Nathalie Dejucq

Wohl Virion Centre, Windeyer Institute of Medical Sciences, London, United Kingdom

Correspondence and current address: Dr. Nathalie Dejucq, GERM-INSERM U435, Campus de Beaulieu, 35 042 Rennes Cedex, France. E-mail: nathalie.dejucq{at}rennes.inserm.fr


arrow
ABSTRACT
 
We studied the replication of HIV-1 macrophage-tropic CCR5-using strains (R5) in CD4+ T cell lines to better understand the switch in co-receptor use of such strains during disease progression and to assess resulting changes in cell tropism. We found that the majority of R5 strains cannot replicate in CD4+ T cell lines without adaptation by serial passage. A small minority of primary R5 isolates, however, were able to infect two T cell lines, Molt4 and SupT1. This expanded tropism was due to the use of undetectable levels of CCR5 rather than CXCR4 or alternative receptors. In contrast, HIV-1SF162 adaptation for replication in the C8166 T cell line was due to the emergence of variant strains that could use CXCR4. Of two variants, one was dual-tropic and one T-tropic, although both could use CCR5 as well as CXCR4. A single mutation in the start codon of the accessory gene vpu accounted for the T-tropic phenotype of the second variant, indicating that a non-functional vpu impairs macrophage tropism. Thus, in vitro and in the absence of an immune response, R5 strains naturally adapt to infect CXCR4+ T cell lines. Such adaptation resembles the rare R5 to X4 switch that occurs in vivo. Mutations in accessory genes (e.g., vpu) not required for replication in rapidly dividing cell lines may also occur in vitro, abrogating replication in primary cell types such as macrophages. Such mutations, however, are normally selected against in vivo.

Key Words: macrophage and T cell lines tropism • CXCR4 • CCR5 • Vpu


arrow
INTRODUCTION
 
Changes in cellular tropism by HIV-1 strains seem to be a key event in the pathogenesis of HIV disease [1 2 3 4 5 6 ] because in half of HIV-infected individuals the emergence of T cell line tropic variants is associated with the development of AIDS [6 , 7 ]. HIV-1 isolates have been classified into two main types: (1) syncytium-inducing (SI), T cell line tropic (T-tropic), rapid/high strains and (2) non-syncytium-inducing (NSI), macrophage-tropic (M-tropic), slow/low strains. In vitro, NSI viruses infect both macrophages and T cells, which are important cell targets for the virus in vivo, but rarely infect T cell lines. In contrast, SI viruses replicate in a range of transformed CD4+ T cell lines [8 ], while their capacity to infect macrophages has been controversial [4 , 9 10 11 12 13 14 15 ]. During primary acute infection, the majority of HIV-1 isolates are NSI [16 ], whereas SI strains emerge during disease progression in about 50% of AIDS patients [5 ]. This emergence often precedes or coincides with a rapid decline in CD4+ cells in blood [17 ]. The selective pressures that drive or prevent this switch are still poorly understood.

Two receptors are required on the surface of the target cell to trigger HIV entry: the CD4 receptor and a co-receptor [18 19 20 ]. Co-receptors have seven transmembrane domains (7TM) and are either members of, or related to, the chemokine receptor family. At least 12 7TM receptors have been shown to act as co-receptors for entry of different HIV-1 strains in vitro [see 21– 24 for reviews]. All HIV-1 strains studied so far, however, use CCR5, CXCR4, or both [14 , 25 ]. The discovery of HIV co-receptors has mainly explained the NSI/ M-tropic versus SI/T-tropic phenotype, by showing that the former strains use CCR5 [19 , 20 , 26 27 28 ], a receptor for CC chemokines RANTES, macrophage inflammatory protein (MIP)-1{alpha}, MIP-1ß, and monocyte chemotactic protein-2 (MCP-2) [29 30 31 32 ], whereas the latter use CXCR4 [18 ], a receptor for the CXC chemokine stromal cell-derived factor 1 (SDF-1) [33 , 34 ]. A new nomenclature for HIV-1 strains was adopted, with isolates that use CCR5 termed R5 viruses, those using CXCR4 designated X4 viruses, and viruses able to use both co-receptors (dual-tropic) called R5X4 [35 ]. Further co-receptors that support infection of cell lines in vitro by various but usually a minority of isolates have also been identified. These include CCR3 [27 , 28 ], APJ [36 ], CCR2b [28 ], CCR8 [37 38 39 ], CX3CR1 [37 ], CCR9 [36 ], ChemR23 [40 ], STRL-33 [41 42 43 ], GPR15 [42 , 44 ], GPR1 [44 ], US28 [45 ], and Leukotriene B4 [46 ]. CCR5 is predominantly expressed on macrophages [11 , 47 48 49 ], dendritic cells [11 , 50 51 52 ], brain microglial cells [53 54 55 ], and memory T cells [56 ] but absent on most T cell lines. CXCR4 is more widely expressed and present on both naive and memory T cells [56 , 57 ] as well as monocytes, and at lower levels on mature macrophages [58 ]. Thus, the cellular tropism of HIV-1 is largely determined by differential usage of chemokine receptors. This simple picture, however, has several exceptions. Hence, some R5 HIV-1 strains do not infect macrophages, although these cells express high levels of CCR5 [59 , 60 ], whereas many primary X4 strains do not replicate in several cell lines expressing CXCR4 [61 ].

Besides env, accessory genes can sometimes interfere with cell tropism, at least in vitro. For instance, vpr, vif, and vpu are nonessential HIV-1 genes that are dispensible for infection and replication in established cell lines, yet are required to various extents for replication in primary macrophages and/or peripheral blood mononuclear cells (PBMCs) [62 63 64 ]. Mutations that affect the function of such genes are probably selected against and rare in vivo, however, may accrue during passage in T cell lines in vitro.

Here we review our recent studies assessing the adaptation of primary R5 strains for replication in T cell lines, the effects on co-receptor use, and the resulting effects on envelope and accessory genes.

INFECTION OF CD4+ T CELL LINES VIA LOW LEVELS OF CCR5
The majority of CCR5-using viruses do not infect CD4+ T cell lines, however, some R5 strains can infect two T cell lines, Molt4 and SupT1 [65 ]. These strains include a molecularly cloned variant virus, HIV-1C3 that was derived from HIV1JR-CSF. HIV-1C3 was adapted in vitro for replication in Molt4 cells after multiple passages. Sequencing revealed that a single amino acid change in the V1 loop accounted for HIV-1C3’s extended tropism for both Molt4 and SupT1 cells. Thus, if the V3 loop on gp120 is a major determinant of both cell tropism [66 67 68 69 70 71 72 73 74 ] and more recently of co-receptor usage [75 76 77 ], other envelope elements are also involved [77 78 79 80 81 ]. Several reports have implicated the V1/V2 loops of gp120 [65 , 82 83 84 85 86 87 ]. The V1/V2 domains, in addition to the required V3 domain, influence the efficiency of replication of HIV-1 in primary macrophages [68 , 85 , 88 ] and in Jurkat T cells [86 ]. Groenink et al. [84 ] described the configuration of a hypervariable locus in the V2 domain that appeared to be predictive for a switch from an NSI to an SI phenotype. V1/V2 sequences act in conjunction with a CCR5 tropic V3 loop to confer CCR3 usage to some NSI strains [87 ]. Kwong et al. [89 ] have recently reported the crystal structure of gp120 complexed with CD4 and a neutralizing antibody. This structure shows that the stems of the V1/V2 loops and V3 loop are located, respectively, on inner and outer domains of gp120 and on either side of a bridging sheet that spans these two domains. The co-receptor binding site is thought to contain amino acids in this bridging sheet and probably residues in the V3 loop. In some circumstances, the V1/V2 loops are dispensible for high-affinity binding to co-receptors [90 ] and viral replication [86 ], yet when present on gp120 they can have a profound influence on tropism and co-receptor use.

We showed that, in addition to HIV-1C3, of 10 R5 viruses tested, two further strains (HIV-1BR92 and HIV-1E80) consistently replicated in Molt4 and SupT1, providing evidence that viruses like the HIV-1C3 variant do exist in vivo (Table 1 ) [91 ]. These strains had only been passaged in PBMCs and did not replicate in other T cell lines tested. For one isolate (HIV-1ADA) that failed to infect either Molt4 or SupT1, we prepared pseudotype virus that carried the vesicular stomatitis virus envelope glycoprotein G. This pseudotype efficiently infected both Molt4 and SupT1, thus indicating that the block to infection occurred early in the replication and could be bypassed by virions carrying foreign envelope glycoprotein.


View this table:
[in this window]
[in a new window]
 
Table 1. SupT1 and Molt4 Infection and Coreceptor Use by R5 Strains

The three Molt4/SupT1-tropic viruses used CCR5 predominantly on CD4+ cell lines (Table 1) and did not replicate in CCR5-negative PBMCs derived from individuals homozygous for {Delta}32 CCR5. They did not use CXCR4, nor was any alternative receptor (CCR8, GPR-15, STRL-33, GPR-1, CX3CR1, D6, CCR1, CCR2b, CCR3) used consistently, although low-level infection via CCR3, STRL-33, GPR-15, and CCR8 was noted occasionally. Infection of Molt4 and SupT1 by each of these three strains was potently inhibited by ligands for CCR5 (AOP-RANTES, RANTES, and MIP-1ß) and by a monoclonal antibody specific for CCR5 (2D7; Fig. 1 ). No block of HIV replication was observed using ligands to other co-receptors, e.g., eotaxin (CCR3) and AMD3100 (CXCR4). CCR5 mRNA was present in both Molt4 and SupT1 by reverse transcriptase-polymerase chain reaction (RT-PCR), although CCR5 protein could not be detected on either the cell surface or in intracellular vesicles through the use of either FACScan or confocal microscopy. The expanded tropism of the three strains was therefore not due to adaptation to a new co-receptor but most probably due to their capacity to exploit extremely low levels of CCR5 on Molt4 and SupT1 cells. This could be further tested by using a cell line expressing various amounts of CCR5, such as the one developed by Platt et al. [92 ].



View larger version (22K):
[in this window]
[in a new window]
 
Figure 1. Inhibition of E80 replication in SupT1 by chemokine receptor ligands. SupT1 were treated with virus alone, virus plus chemokine receptor ligand (AOP-Rantes, MIP1ß, AMD3100, eotaxin), or virus plus the CCR5-specific mAb 2D7 or a control anti-CXCR4 mAb. The p24 level detected in presence of inhibitor is represented as a percentage of the maximum p24 value obtained during the time course for the virus alone (100% infectivity). Similar results were obtained on Molt4 (data not shown).

The capacity of R5 strains to use low levels of CCR5 could have important significance in vivo by allowing viruses to infect new cell populations and spreading the infection to new body compartments. Adaptation for one cell type, however, may compromise infectivity for others. Like other R5 isolates, HIV-1E80 replicates efficiently in primary macrophages but has consistently failed to infect fetal brain cell cultures containing CCR5+ microglia [93 ]. We are currently assessing whether other Molt4/SupT1 tropic strains (HIV-1C3 and HIV-1BR92) also have a reduced capacity to infect brain microglia.


arrow
ADAPTATION OF AN R5 STRAIN TO USE CXCR4 AND INFLUENCE ON REPLICATION IN MACROPHAGES
 
HIV-1SF162 variants that replicated in C8166 cells emerged after only a few passages after infection. C8166 cells do not express CCR5 and replicating virus was associated with the production of large syncytia. Two HIV-1SF162 variants were isolated that efficiently infected C8166. One variant retained the ability to infect macrophages and PBMCs, similar to wild-type HIV-1SF162 and was therefore dual-tropic. The second variant became T cell line tropic and replicated poorly in both macrophages and PBMCs (Fig. 2 ).



View larger version (29K):
[in this window]
[in a new window]
 
Figure 2. Cell tropism of SF162 and variants. Infectivity for PBMCs (TCID50/ml), the T cell line C8166 (TCID50/ml), and macrophages (FFU/ml) are shown as Log10 infectivity.

Sequence analysis revealed that both T- and dual-tropic variants had two common amino acid substitutions in the V3 loop (IGPGRA to RGPGRV). One of these (I to R) increased the overall positive charge of the V3 loop, a property associated with an SI phenotype and CXCR4 use. Few other amino-acid changes were observed outside the variable regions of env, mostly common to both strains. A single base mutation in the translation initiation codon of vpu (ATG to ATA) was also noted for T-tropic variant, whereas the wild-type and dual-tropic strains retained the ATG codon. C8166 infection was associated with the capacity of the two variants to use CXCR4 as well as CCR5. A role for other co-receptors was not implicated. Chimeric molecular clones were constructed to ascertain the role of the envelope and vpu mutations in the loss of macrophage tropism. Complete envelope genes derived from either the dual-tropic or T-tropic variants conferred macrophage infection, whereas loss of macrophage infection was determined entirely by a single mutation in vpu [N. Dejucq et al., unpublished observations].

In vivo, co-receptor switching for R5 strains to CXCR4 use is apparently rare, with only about half of AIDS patients carrying SI strains. The pressures in vivo that select against CXCR4 use are currently unclear, although immune (neutralizing antibodies) [94 ] and non-immune (SDF-1) mechanisms [95 ] have been suggested. Whatever the selective pressure, it appears to wane late in disease when X4 strains emerge and persist. In vivo, CXCR4 use is associated with acquisition of positively charged amino acids at one (or both) of two specific sites in the V3 loop (e.g., CTRPNNNTRKRIRIGPGRAFYATGKIIGNIRQAHC). T cell line-adapted strains, e.g., the 17.11 variant of HIV-1JR-CSF [96 ] often carry positive amino acids at these sites, however, the HIV-1SF162 variants described here [N. Dejucq et al., unpublished results] contain an additional positive amino acid (I to R change) at a distinct site. Different selection pressures during T cell line adaptation may allow the V3 loop to adopt subtle conformations in vitro, thus allowing positive amino acids at alternative sites to confer CXCR4 use. Cheng-Mayer’s group have also described an HIV-1SF162 variant selected independently for replication in the HUT78 T cell line [97 ]. Coincidently, Cheng-Mayer’s variant contained the same V3 loop amino acid substitutions as our variants, which were shown to confer CXCR4 use and infectivity for HUT78 [59 ].


arrow
DISCUSSION
 
Most primary R5 viruses can readily adapt in vitro to use CXCR4 for infection of T cell lines. We suspect that some strains need few amino acid substitutions to acquire CXCR4 use because they rapidly adapt, whereas others need more extensive passages and must require multiple changes. The potential of R5 strains to acquire an X4 phenotype in vitro is consistent with the presence of unidentified selective pressures that usually prevent CXCR4 use in vivo until late in disease. A minority of R5 viruses can, however, infect particular T cell lines without adaptation to use CXCR4. These strains have the ability to exploit low concentrations of CCR5, which confer them an expanded tropism.

The accidental infection of a laboratory worker by the TCLA CXCR4-using HIV-1 strain, IIIB [98 ] has enabled some insight into the effects of T cell line passage on the in vivo properties of such viruses. Whereas the parental HIV-1IIIB strain is T tropic and infects primary macrophages inefficiently, isolates from the infected worker were macrophage-tropic. Thus, adaptation occurred to allow the virus to infect new cell targets and become more infectious in vivo. Six unique amino acid mutations in the V3 loop region accounted for this increased replication. The change in tropism, however, was not associated with a switch to CCR5 use because the isolates continued to use CXCR4 as the sole co-receptor for entry into PBMCs [99 ]. There are no reports on the current health of this patient to assess the virulence of the HIV-1IIIB strains.

Mutations in vpu have previously been reported to affect macrophage [62 , 63 , 100 , 101 ] and PBMC replication [63 , 100 ]. Vpu has two domains that are responsible for distinct functions. The amino terminus of Vpu forms a transmembrane region that has been implicated as an ion channel [102 ], whereas the cytoplasmic carboxy-terminal domain of the protein interacts CD4 molecules that have formed complexes with viral envelope glycoproteins. CD4 is then redirected into proteosomes for degradation [103 ]. Both Vpu functions contribute to release of virus particles from the cell surface [104 ]. Accessory genes such as vpu and vpr are not required for replication in rapidly dividing T cell lines and thus mutations will simply accumulate in such genes with multiple rounds of replication. However, for macrophage replication where virus particles are predominantly bud into internal vesicles, a defective vpu may seriously affect cell-to-cell spread of infection. Moreover, there could be in vivo situations where mutations in accessory genes may occur and prevail. For instance, when virus is replicating in T cells that are rapidly dividing after immune activation.

Naturally occurring mutations in the start codon of vpu have previously been reported [105 , 106 ]. Schubert et al. described an HIV-1 isolate (AD8) that has evolved a mechanism to compensate for the loss of Vpu function. HIV-2 and SIVs do not have a vpu gene, however, virion release appears to be controlled by determinants in the envelope glycoprotein. HIV-2 envelope can thus complement a vpu-defective HIV-1 strain [107 ]. The AD8 envelope appears to function in the same way, although the mechanisms directed by such envelopes are unclear. The generation of mutations in accessory genes such as vpu is unlikely to reflect events in vivo. Viruses that carry mutations in accessory genes are likely to be attenuated in vivo [108 , 109 ] as shown for SIVmac strains mutated for the loss of up to three accessory genes [110 ]. Such strains may be candidates as live vaccines [111 ].

Although not reflecting the in vivo situation, in vitro experiments show that shifts in cell tropism can result from either envelope change and/or mutations that abrogate accessory gene functions, and are not necessarily linked to a shift in co-receptor usage.


arrow
ACKNOWLEDGEMENTS
 
This work was supported partly by an MRC program grant and partly by an EU Biomed II grant. We thank Robin Weiss for constructive criticism as well as Graham Simmons, Sam Hibbitts, Jackie Reeves, and Aine Mc Knight for help and suggestions. We are particularly grateful to Paul Clapham for his help in preparing the manuscript and for his kind support.


arrow
REFERENCES
 
    1
  1. Goudsmit, J. (1995) The role of viral diversity in HIV pathogenesis J. Acquir. Immune Defic. Syndr. Hum. Retrovirol. 10,S15-S19
  2. 2
  3. Koot, M., van ’t Wout, A. B., Kootstra, N. A., de Goede, R. E., Tersmette, M., Schuitemaker, H. (1996) Relation between changes in cellular load, evolution of viral phenotype, and the clonal composition of virus populations in the course of human immunodeficiency virus type 1 infection J. Infect. Dis. 173,349-354[Medline]
  4. 3
  5. Richman, D. D. (1994) Resistance, drug failure, and disease progression AIDS Res. Hum. Retroviruses 10,901-905[Medline]
  6. 4
  7. Schuitemaker, H., Koot, M., Kootstra, N. A., Dercksen, M. W., de Goede, R. E., van Steenwijk, R. P., Lange, J. M., Schattenkerk, J. K., Miedema, F., Tersmette, M. (1992) Biological phenotype of human immunodeficiency virus type 1 clones at different stages of infection: progression of disease is associated with a shift from monocytotropic to T-cell-tropic virus population J. Virol. 66,1354-1360[Abstract/Free Full Text]
  8. 5
  9. Tersmette, M., de Goede, R. E., Al, B. J., Winkel, I. N., Gruters, R. A., Cuypers, H. T., Huisman, H. G., Miedema, F. (1988) Differential syncytium-inducing capacity of human immunodeficiency virus isolates: frequent detection of syncytium-inducing isolates in patients with acquired immunodeficiency syndrome (AIDS) and AIDS-related complex J. Virol. 62,2026-2032[Abstract/Free Full Text]
  10. 6
  11. Tersmette, M., Gruters, R. A., de Wolf, F., de Goede, R. E., Lange, J. M., Schellekens, P. T., Goudsmit, J., Huisman, H. G., Miedema, F. (1989) Evidence for a role of virulent human immunodeficiency virus (HIV) variants in the pathogenesis of acquired immunodeficiency syndrome: studies on sequential HIV isolates J. Virol. 63,2118-2125[Abstract/Free Full Text]
  12. 7
  13. Connor, R. I., Mohri, H., Cao, Y., Ho, D. D. (1993) Increased viral burden and cytopathicity correlate temporally with CD4+ T-lymphocyte decline and clinical progression in human immunodeficiency virus type 1-infected individuals J. Virol. 67,1772-1777[Abstract/Free Full Text]
  14. 8
  15. Fenyo, E. M., Morfeldt Manson, L., Chiodi, F., Lind, B., von Gegerfelt, A., Albert, J., Olausson, E., Asjo, B. (1988) Distinct replicative and cytopathic characteristics of human immunodeficiency virus isolates J. Virol. 62,4414-4419[Abstract/Free Full Text]
  16. 9
  17. Valentin, A., Albert, J., Fenyo, E. M., Asjo, B. (1994) Dual tropism for macrophages and lymphocytes is a common feature of primary human immunodeficiency virus type 1 and 2 isolates J. Virol. 68,6684-6689[Abstract/Free Full Text]
  18. 10
  19. Karita, E., Nkengasong, J. N., Willems, B., Vanham, G., Fransen, K., Heyndrickx, L., Janssens, W., Piot, P., van der Groen, G. (1997) Macrophage-tropism of HIV-1 isolates of different genetic subtypes AIDS 11,1303-1304[Medline]
  20. 11
  21. Zaitseva, M., Blauvelt, A., Lee, S., Lapham, C. K., Klaus Kovtun, V., Mostowski, H., Manischewitz, J., Golding, H. (1997) Expression and function of CCR5 and CXCR4 on human Langerhans cells and macrophages: implications for HIV primary infection Nat. Med. 3,1369-1375[Medline]
  22. 12
  23. Yi, Y., Rana, S., Turner, J. D., Gaddis, N., Collman, R. G. (1998) CXCR-4 is expressed by primary macrophages and supports CCR5-independent infection by dual-tropic but not T-tropic isolates of human immunodeficiency virus type 1 J. Virol. 72,772-777[Abstract/Free Full Text]
  24. 13
  25. Fear, W. R., Kesson, A. M., Naif, H., Lynch, G. W., Cunningham, A. L. (1998) Differential tropism and chemokine receptor expression of human immunodeficiency virus type 1 in neonatal monocytes, monocyte-derived macrophages, and placental macrophages J. Virol. 72,1334-1344[Abstract/Free Full Text]
  26. 14
  27. Simmons, G., Wilkinson, D., Reeves, J. D., Dittmar, M. T., Beddows, S., Weber, J., Carnegie, G., Desselberger, U., Gray, P. W., Weiss, R. A., Clapham, P. R. (1996) Dual-tropic, primary, syncytium-inducing HIV-1 strains that can use either Lestr or CCR5 as co-receptors for virus entry J. Virol. 70,8355-8360[Abstract/Free Full Text]
  28. 15
  29. Simmons, G., Reeves, J., McKnight, A., Dejucq, N., Hibbitts, S., Power, C., Aarons, E., Schols, D., de Clercq, E., Proudfoot, A., Clapham, P. (1998) CXCR4 as a functionnal co-receptor for Human Immunodeficiency Virus type 1 infection of primary macrophages J. Virol. 72,8453-8457[Abstract/Free Full Text]
  30. 16
  31. Zhu, T., Mo, H., Wang, N., Nam, D. S., Cao, Y., Koup, R. A., Ho, D. D. (1993) Genotypic and phenotypic characterization of HIV-1 patients with primary infection Science 261,1179-1181
  32. 17
  33. Koot, M., Keet, I. P., Vos, A. H., de Goede, R. E., Roos, M. T., Coutinho, R. A., Miedema, F., Schellekens, P. T., Tersmette, M. (1993) Prognostic value of HIV-1 syncytium-inducing phenotype for rate of CD4+ cell depletion and progression to AIDS Ann. Intern. Med. 118,681-688[Abstract/Free Full Text]
  34. 18
  35. Feng, Y., Broder, C. C., Kennedy, P. E., Berger, E. A. (1996) HIV-1 entry cofactor: functional cDNA cloning of a seven-transmembrane G-protein coupled receptor Science 272,872-877[Abstract]
  36. 19
  37. Dragic, T., Litwin, V., Allaway, G., Martin, S. R., Huang, Y., Nagashima, K. A., Cayanan, C., Maddon, P. J., Koup, R. A., Moore, J. P., Paxton, W. A. (1996) HIV-1 entry into CD4+ cells is mediated by the chemokine receptor CC-CKR5 Nature 381,667-673[Medline]
  38. 20
  39. Deng, H., Liu, R., Elmeier, W., Choe, S., Unutmaz, D., Burkhart, M., Di Marzio, P., Marmon, S., Sutton, R. E., Hill, C. M., Davis, C. B., Peiper, S. C., Schall, T. J., Littman, D. R., Landau, N. R. (1996) Identification of a major co-receptor for primary isolates of HIV-1 Nature 381,661-666[Medline]
  40. 21
  41. Berger, E. A. (1997) HIV entry and tropism: the chemokine receptor connection AIDS 11,S3-S16
  42. 22
  43. Moore, J. P. (1997) Coreceptors: implications for HIV pathogenesis and therapy Science 276,51-52[Free Full Text]
  44. 23
  45. Clapham, P. R., Weiss, R. A. (1997) Immunodeficiency viruses. Spoilt for choice of co-receptors Nature 388,230-231[Medline]
  46. 24
  47. Doranz, B. J., Berson, J. F., Rucker, J., Doms, R. W. (1997) Chemokine receptors as fusion cofactors for human immunodeficiency virus type 1 (HIV-1) Immunol. Res. 16,15-28[Medline]
  48. 25
  49. Zhang, L., Huang, Y., He, T., Cao, Y., Ho, D. D. (1996) HIV-1 subtype and second-receptor use Nature 383,768[Medline]
  50. 26
  51. Alkhatib, G., Combadiere, C., Broder, C. C., Feng, Y., Kennedy, P. E., Murphy, P. M., Berger, E. A. (1996) CC CKR5: a RANTES, MIP-1{alpha}, MIP-1ß receptor as fusion cofactor for macrophage-tropic HIV-1 Science 272,1955-1958[Abstract]
  52. 27
  53. Choe, H., Farzan, M., Sun, Y., Sullivan, N., Rollins, B., Ponath, P. D., Wu, L., Mackay, C. R., LaRosa, G., Newman, W., Gerard, N., Gerard, C., Sodroski, J. (1996) The beta-chemokine receptors CCR3 and CCR5 facilitate infection by primary HIV-1 isolates Cell 85,1135-1148[Medline]
  54. 28
  55. Doranz, B. J., Rucker, J., Yi, Y., Smyth, R. J., Samson, M., Peiper, S. C., Parmentier, M., Collman, R. G., Doms, R. W. (1996) A dual-tropic primary HIV-1 isolate that uses fusin and the beta-chemokine receptors CKR-5, CKR-3, and CKR-2b as fusion cofactors Cell 85,1149-1158[Medline]
  56. 29
  57. Combadiere, C., Ahuja, S. K., Tiffany, H. L., Murphy, P. M. (1996) Cloning and functional expression of CC CKR5, a human monocyte CC chemokine receptor selective for MIP-1(alpha), MIP-1(beta), and RANTES J. Leukoc. Biol. 60,147-152[Abstract]
  58. 30
  59. Raport, C. J., Gosling, J., Schweickart, V. L., Gray, P. W., Charo, I. F. (1996) Molecular cloning and functional characterization of a novel human CC chemokine receptor (CCR5) for RANTES, MIP-1{alpha}, and MIP-1ß J. Biol. Chem. 271,17161-17166[Abstract/Free Full Text]
  60. 31
  61. Samson, M., Labbe, O., Mollereau, C., Vassart, G., Parmentier, M. (1996) Molecular cloning and functional expression of a new human CC-chemokine receptor gene Biochemistry 11,3362-3367
  62. 32
  63. Gong, W., Howard, O. M., Turpin, J. A., Grimm, M. C., Ueda, H., Gray, P. W., Raport, C. J., Oppenheim, J. J., Wang, J. M. (1998) Monocyte chemotactic protein-2 activates CCR5 and blocks CD4/CCR5-mediated HIV-1 entry/replication J. Biol. Chem. 273,4289-4292[Abstract/Free Full Text]
  64. 33
  65. Bleul, C. C., Farzan, M., Choe, H., Parolin, C., Clark-Lewis, I., Sodroski, J., Springer, T. A. (1996) The lymphocyte chemoattractant SDF-1 is a ligand for LESTR/fusin and blocks HIV-1 entry Nature 382,829-833[Medline]
  66. 34
  67. Oberlin, E., Amara, A., Bachelerie, F., Bessia, C., Virelizier, J.-L., Arenzana-Seisdedos, F., Schwartz, O., Heard, J.-M., Clark-Lewis, I., Legler, D. F., Loetscher, M., Baggiolini, M., Moser, B. (1996) The CXC chemokine SDF-1 is the ligand for LESTR/fusin and prevents infection by T-cell-line-adapted HIV-1 Nature 382,833-835[Medline]
  68. 35
  69. Berger, E. A., Doms, R. W., Fenyo, E. M., Korber, B. T., Littman, D. R., Moore, J. P., Sattentau, Q. J., Schuitemaker, H., Sodroski, J., Weiss, R. A. (1998) A new classification for HIV-1 Nature 391,240[Medline]
  70. 36
  71. Choe, H., Farzan, M., Konkel, M., Martin, K., Sun, Y., Marcon, L., Cayabyab, M., Berman, M., Dorf, M. E., Gerard, N., Gerard, C., Sodroski, J. (1998) The orphan seven-transmembrane receptor apj supports the entry of primary T-cell-line-tropic and dual-tropic human immunodeficiency virus type 1 J. Virol. 72,6113-6118[Abstract/Free Full Text]
  72. 37
  73. Rucker, J., Edinger, A. L., Sharron, M., Samson, M., Lee, B., Berson, J. F., Yi, Y., Margulies, B., Collman, R. G., Doranz, B. J., Parmentier, M., Doms, R. W. (1997) Utilization of chemokine receptors, orphan receptors, and herpesvirus-encoded receptors by diverse human and simian immunodeficiency viruses J. Virol. 71,8999-9007[Abstract/Free Full Text]
  74. 38
  75. Jinno, A., Shimizu, N., Soda, Y., Haraguchi, Y., Kitamura, T., Hoshino, H. (1998) Identification of the chemokine receptor TER1/CCR8 expressed in brain-derived cells and T cells as a new coreceptor for HIV-1 infection Biochem. Biophys. Res. Commun. 243,497-502[Medline]
  76. 39
  77. Horuk, R. (1998) Chemokines beyond inflammation Nature 393,524-525[Medline]
  78. 40
  79. Samson, M., Edinger, A. L., Stordeur, P., Rucker, J., Verhasselt, V., Sharron, M., Govaerts, C., Mollereau, C., Vassart, G., Doms, R. W., Parmentier, M. (1998) ChemR23, a putative chemoattractant receptor, is expressed in monocyte-derived dendritic cells and macrophages and is a coreceptor for SIV and some primary HIV-1 strains Eur. J. Immunol. 28,1689-1700[Medline]
  80. 41
  81. Alkhatib, G., Liao, F., Berger, E. A., Farber, J. M., Peden, K. W. (1997) A new SIV co-receptor, STRL33 Nature 388,238[Medline]
  82. 42
  83. Deng, H. K., Unutmaz, D., KewalRamani, V. N., Littman, D. R. (1997) Expression cloning of new receptors used by simian and human immunodeficiency viruses Nature 388,296-300[Medline]
  84. 43
  85. Loetscher, M., Amara, A., Oberlin, E., Brass, N., Legler, D., Loetscher, P., D’Apuzzo, M., Meese, E., Rousset, D., Virelizier, J. L., Baggiolini, M., Arenzana Seisdedos, F., Moser, B. (1997) TYMSTR, a putative chemokine receptor selectively expressed in activated T cells, exhibits HIV-1 coreceptor function Curr. Biol. 7,652-660[Medline]
  86. 44
  87. Farzan, M., Choe, H., Martin, K., Marcon, L., Hofmann, W., Karlsson, G., Sun, Y., Barrett, P., Marchand, N., Sullivan, N., Gerard, N., Gerard, C., Sodroski, J. (1997) Two orphan seven-transmembrane segment receptors which are expressed in CD4-positive cells support simian immunodeficiency virus infection J. Exp. Med. 186,405-411[Abstract/Free Full Text]
  88. 45
  89. Pleskoff, O., Treboute, C., Brelot, A., Heveker, N., Seman, M., Alizon, M. (1997) Identification of a chemokine receptor encoded by human cytomegalovirus as a cofactor for HIV-1 entry Science 276,1874-1878[Abstract/Free Full Text]
  90. 46
  91. Owman, C., Garzino-Demo, A., Cocchi, F., Popovic, M., Sabirsh, A., Gallo, R. C. (1998) The leukotriene B4 receptor functions as a novel type of coreceptor mediating entry of primary HIV-1 isolates into CD4-positive cells Proc. Natl. Acad. Sci. USA 95,9530-9534[Abstract/Free Full Text]
  92. 47
  93. Rana, S., Besson, G., Cook, D. G., Rucker, J., Smyth, R. J., Yi, Y., Turner, J. D., Guo, H. H., Du, J. G., Peiper, S. C., Lavi, E., Samson, M., Libert, F., Liesnard, C., Vassart, G., Doms, R. W., Parmentier, M., Collman, R. G. (1997) Role of CCR5 in infection of primary macrophages and lymphocytes by macrophage-tropic strains of human immunodeficiency virus: resistance to patient-derived and prototype isolates resulting from the delta ccr5 mutation J. Virol. 71,3219-3227[Abstract/Free Full Text]
  94. 48
  95. Tuttle, D. L., Harrison, J. K., Anders, C., Sleasman, J. W., Goodenow, M. M. (1998) Expression of CCR5 increases during monocyte differentiation and directly mediates macrophage susceptibility to infection by human immunodeficiency virus type 1 J. Virol. 72,4962-4969[Abstract/Free Full Text]
  96. 49
  97. Wu, L., Paxton, W. A., Kassam, N., Ruffing, N., Rottman, J. B., Sullivan, N., Choe, H., Sodroski, J., Newman, W., Koup, R. A., Mackay, C. R. (1997) CCR5 levels and expression pattern correlate with infectability by macrophage-tropic HIV-1, in vitro J. Exp. Med. 185,1681-1691[Abstract/Free Full Text]
  98. 50
  99. Granelli Piperno, A., Moser, B., Pope, M., Chen, D., Wei, Y., Isdell, F., O’Doherty, U., Paxton, W., Koup, R., Mojsov, S., Bhardwaj, N., Clark Lewis, I., Baggiolini, M., Steinman, R. M. (1996) Efficient interaction of HIV-1 with purified dendritic cells via multiple chemokine coreceptors J. Exp. Med. 184,2433-2438[Abstract/Free Full Text]
  100. 51
  101. Blauvelt, A., Asada, H., Saville, M. W., Klaus Kovtun, V., Altman, D. J., Yarchoan, R., Katz, S. I. (1997) Productive infection of dendritic cells by HIV-1 and their ability to capture virus are mediated through separate pathways J. Clin. Invest. 100,2043-2053[Medline]
  102. 52
  103. Ayehunie, S., Garcia Zepeda, E. A., Hoxie, J. A., Horuk, R., Kupper, T. S., Luster, A. D., Ruprecht, R. M. (1997) Human immunodeficiency virus-1 entry into purified blood dendritic cells through CC and CXC chemokine coreceptors Blood 90,1379-1386[Abstract/Free Full Text]
  104. 53
  105. He, J., Chen, Y., Farzan, M., Choe, H., Ohagen, A., Gartner, S., Busciglio, J., Yang, X., Hofmann, W., Newman, W., Mackay, C. R., Sodroski, J., Gabuzda, D. (1997) CCR3 and CCR5 are co-receptors for HIV-1 infection of microglia Nature 385,645-649[Medline]
  106. 54
  107. Ghorpade, A., Xia, M. Q., Hyman, B. T., Persidsky, Y., Nukuna, A., Bock, P., Che, M., Limoges, J., Gendelman, H. E., Mackay, C. R. (1998) Role of the beta-chemokine receptors CCR3 and CCR5 in human immunodeficiency virus type 1 infection of monocytes and microglia J. Virol. 72,3351-3361[Abstract/Free Full Text]
  108. 55
  109. Shieh, J. T., Albright, A. V., Sharron, M., Gartner, S., Strizki, J., Doms, R. W., Gonzalez Scarano, F. (1998) Chemokine receptor utilization by human immunodeficiency virus type 1 isolates that replicate in microglia J. Virol. 72,4243-4249[Abstract/Free Full Text]
  110. 56
  111. Bleul, C. C., Wu, L., Hoxie, J. A., Springer, T. A., Mackay, C. R. (1997) The HIV coreceptors CXCR4 and CCR5 are differentially expressed and regulated on human T lymphocytes Proc. Natl. Acad. Sci. USA 94,1925-1930[Abstract/Free Full Text]
  112. 57
  113. Mo, H., Monard, S., Pollack, H., Ip, J., Rochford, G., Wu, L., Hoxie, J., Borkowsky, W., Ho, D. D., Moore, J. P. (1998) Expression patterns of the HIV type 1 coreceptors CCR5 and CXCR4 on CD4+ T cells and monocytes from cord and adult blood AIDS. Res. Hum. Retroviruses 14,607-617[Medline]
  114. 58
  115. McKnight, Á, Wilkinson, D., Simmons, G., Talbot, S., Picard, L., Ahuja, M., Hoxie, J. A., Clapham, P. R. (1997) Inhibition of HIV fusion by a monoclonal antibody to a co-receptor (CXCR4) is both cell type and virus strain dependent J. Virol. 71,1662-1696[Abstract/Free Full Text]
  116. 59
  117. Cheng Mayer, C., Liu, R., Landau, N. R., Stamatatos, L. (1997) Macrophage tropism of human immunodeficiency virus type 1 and utilization of the CC-CKR5 coreceptor J. Virol. 71,1657-1661[Abstract/Free Full Text]
  118. 60
  119. Dittmar, M. T., McKnight, Á, Simmons, G., Clapham, P. R., Weiss, R. A., Simmonds, P. (1997) HIV-1 tropism and co-receptor usage Nature 385,495-496[Medline]
  120. 61
  121. Kozak, S. L., Platt, E. J., Madani, N., Ferro, F. E., Jr, Peden, K., Kabat, D. (1997) CD4, CXCR-4, and CCR-5 dependencies for infections by primary patient and laboratory-adapted isolates of human immunodeficiency virus type 1 J. Virol. 71,873-882[Abstract/Free Full Text]
  122. 62
  123. Balliet, J. W., Kolson, D. L., Eiger, G., Kim, F. M., McGaan, K. A., Srinivasan, A., Collman, R. (1994) Distinct effects in primary macrophages and lymphocytes of the human immunodeficiency virus type 1 accessory genes vpr, vpu and nef Virology 200,623-631[Medline]
  124. 63
  125. Kawamura, M., Ishizaki, T., Ishimoto, A., Shioda, T., Kitamura, T., Adachi, A. (1994) Growth ability of human immunodeficiency virus type 1 auxiliary gene mutants in primary blood macrophage cultures J. Gen. Virol. 75,2427-2431[Abstract/Free Full Text]
  126. 64
  127. Gabuzda, D., He, J., Ohagen, A., Vallat, A. V. (1998) Chemokine receptors in HIV-1 infection of the central nervous system Semin. Immunol. 10,203-213[Medline]
  128. 65
  129. Boyd, M. T., Simpson, G. R., Cann, A. J., Johnson, M. A., Weiss, R. A. (1993) A single amino acid substitution in the V1 loop of human immunodeficiency virus type 1 gp120 alters cellular tropism J. Virol. 67,3649-3652[Abstract/Free Full Text]
  130. 66
  131. Hwang, S. R., Boyle, T. J., Lyerly, K., Cullen, B. R. (1992) Identification of the envelope V3 loop as the primary determinant of cell tropism in HIV-1 Science 253,71-74
  132. 67
  133. Chesebro, B., Nishio, J., Perryman, S., Cann, A., O’Brien, W. A., Koyanagi, Y., Chen, I. S. Y., Wehrly, K. (1991) Identification of human immunodeficiency virus envelope gene sequences influencing viral entry into CD4-positive HeLa cells, T-leukemia cells, and macrophages J. Virol. 65,5782-5789[Abstract/Free Full Text]
  134. 68
  135. Westervelt, P., Gendelman, H. E., Ratner, L. (1991) Identification of a determinant within the human immunodeficiency virus 1 surface envelope glycoprotein critical for productive infection of primary monocytes Proc. Natl. Acad. Sci. USA 88,3097-3101[Abstract/Free Full Text]
  136. 69
  137. Shioda, T., Levy, J. A., Cheng-Mayer, C. (1991) Macrophage and T-cell line tropisms of HIV-1 are determined by specific regions of the envelope gp120 gene Nature 349,167-169[Medline]
  138. 70
  139. Sharpless, N. E., O’Brien, W. A., Verdin, E., Kufta, C. V., Chen, I. S. Y., Dubois-Dalcq, M. (1992) Human immunodeficiency virus type 1 tropism for brain microglial cells is determined by a region of the env glycoprotein that also controls macrophage tropism J. Virol. 66,2588-2593[Abstract/Free Full Text]
  140. 71
  141. Mammano, F., Salvatori, F., Ometto, L., Panozzo, M., Chieco Bianchi, L., De Rossi, A. (1995) Relationship between the V3 loop and the phenotypes of human immunodeficiency virus type 1 (HIV-1) isolates from children perinatally infected with HIV-1 J. Virol. 69,82-92[Abstract/Free Full Text]
  142. 72
  143. Bhattacharyya, D., Brooks, B. R., Callahan, L. (1996) Positioning of positively charged residues in the V3 loop correlates with HIV type 1 syncytium-inducing phenotype AIDS Res. Hum. Retroviruses 12,83-90[Medline]
  144. 73
  145. Chesebro, B., Wehrly, K., Nishio, J., Perryman, S. (1996) Mapping of independent V3 envelope determinants of human immunodeficiency virus type 1 macrophage tropism and syncytium formation in lymphocytes J. Virol. 70,9055-9059[Abstract/Free Full Text]
  146. 74
  147. Trujillo, J. R., Wang, W. K., Lee, T. H., Essex, M. (1996) Identification of the envelope V3 loop as a determinant of a CD4-negative neuronal cell tropism for HIV-1 Virology 217,613-617[Medline]
  148. 75
  149. Speck, R. F., Wehrly, K., Platt, E. J., Atchison, R. E., Charo, I. F., Kabat, D., Chesebro, B., Goldsmith, M. A. (1997) Selective employment of chemokine receptors as human immunodeficiency virus type 1 coreceptors determined by individual amino acids within the envelope V3 loop J. Virol. 71,7136-7139[Abstract/Free Full Text]
  150. 76
  151. Xiao, L., Owen, S. M., Goldman, I., Lal, A. A., deJong, J. J., Goudsmit, J., Lal, R. B. (1998) CCR5 coreceptor usage of non-syncytium-inducing primary HIV-1 is independent of phylogenetically distinct global HIV-1 isolates: delineation of consensus motif in the V3 domain that predicts CCR-5 usage Virology 240,83-92[Medline]
  152. 77
  153. Rizzuto, C. D., Wyatt, R., Hernandez Ramos, N., Sun, Y., Kwong, P. D., Hendrickson, W. A., Sodroski, J. (1998) A conserved HIV gp120 glycoprotein structure involved in chemokine receptor binding Science 280,1949-1953[Abstract/Free Full Text]
  154. 78
  155. Kim, F. M., Kolson, D. L., Balliet, J. W., Srinivasan, A., Collman, R. G. (1995) V3-independent determinants of macrophage tropism in a primary human immunodeficiency virus type 1 isolate J. Virol. 69,1755-1761[Abstract/Free Full Text]
  156. 79
  157. Trkola, A., Dragic, T., Arthos, J., Binley, J. M., Olson, W. C., Allaway, G. P., Cheng-Meyer, C., Robinson, J., Maddon, P. J., Moore, J. P. (1996) CD4-dependent, antibody-sensitive interactions between HIV-1 and its co-receptor CCR-5 Nature 384,184-187[Medline]
  158. 80
  159. Bieniasz, P. D., Fridell, R. A., Aramori, I., Ferguson, S. S. G., Caron, M. G., Cullen, B. R. (1997) HIV-1 induced cell fusion is mediated by multiple regions within both the viral envelope and the CCR-5 co-receptor EMBO J 16,2599-2609[Medline]
  160. 81
  161. Reeves, J. D., Schulz, T. F. (1997) The CD4-independent tropism of human immunodeficiency virus type 2 involves several regions of the envelope protein and correlates with a reduced activation threshold for envelope-mediated fusion J. Virol. 71,1453-1465[Abstract/Free Full Text]
  162. 82
  163. Andeweg, A. C., Leeflang, P., Osterhaus, A. D., Bosch, M. L. (1993) Both the V2 and V3 regions of the human immunodeficiency virus type 1 surface glycoprotein functionally interact with other envelope regions in syncytium formation J. Virol. 67,3232-3239[Abstract/Free Full Text]
  164. 83
  165. Sullivan, N., Thali, M., Furman, C., Ho, D. D., Sodroski, J. (1993) Effects of amino acid changes in the V2 region of the human immunodeficiency virus type 1 gp120 glycoprotein on subunit association, syncytium formation and recognition by neutralizing antibody J. Virol. 67,3674-3679[Abstract/Free Full Text]
  166. 84
  167. Groenik, M., Fouchier, R. A. M., Broersen, S., Baker, C. H., Koot, M., van’t Wout, A. B., Huisman, H. G., Miedema, F., Tersmette, M., Schuitemaker, H. (1993) Relation of phenotype evolution of HIV-1 to envelope V2 configuration Science 260,1513-1515[Abstract/Free Full Text]
  168. 85
  169. Koito, A., Harrowe, G., Levy, J. A., Cheng-Mayer, C. (1994) Functional role of the V1/V2 region of human immunodeficiency virus type 1 envelope glycoprotein gp120 in infection of primary macrophages and soluble CD4 neutralization J. Virol. 68,2253-2259[Abstract/Free Full Text]
  170. 86
  171. Cao, J., Sullivan, N., Desjardin, E., Parolin, C., Robinson, J., Wyatt, R., Sodroski, J. (1997) Replication and neutralization of human immunodeficiency virus type 1 lacking the V1 and V2 variable loops of the gp120 envelope glycoprotein J. Virol. 71,9808-9812[Abstract/Free Full Text]
  172. 87
  173. Ross, T. M., Cullen, B. R. (1998) The ability of HIV type 1 to use CCR-3 as a coreceptor is controlled by envelope V1/V2 sequences acting in conjunction with a CCR-5 tropic V3 loop Proc. Natl. Acad. Sci. USA 95,7682-7686[Abstract/Free Full Text]
  174. 88
  175. Shioda, T., Levy, J. A., Cheng Mayer, C. (1992) Small amino acid changes in the V3 hypervariable region of gp120 can affect the T-cell-line and macrophage tropism of human immunodeficiency virus type 1 Proc. Natl. Acad. Sci. USA 89,9434-9438[Abstract/Free Full Text]
  176. 89
  177. Kwong, P. D., Wyatt, R., Robinson, J., Sweet, R. W., Sodroski, J., Hendrickson, W. A. (1998) Structure of an HIV gp120 envelope glycoprotein in complex with the CD4 receptor and a neutralizing human antibody Nature 393,648-659[Medline]
  178. 90
  179. Wu, L., Gerard, N. P., Wyatt, R., Choe, H., Parolin, C., Ruffing, N., Borsetti, A., Cardoso, A. A., Desjardin, E., Newman, W., Gerard, C., Sodroski, J. (1996) CD4-induced interaction of primary HIV-1 gp120 glycoproteins with the chemokine receptor CCR-5 Nature 384,179-183[Medline]
  180. 91
  181. Dejucq, N., Simmons, G., Clapham, P. R. (1999) Expanded tropism of primary human immunodeficiency virus type 1 R5 strains to CD4(+) T-cell lines determined by the capacity to exploit low concentrations of CCR5 J. Virol. 73,7842-7847[Abstract/Free Full Text]
  182. 92
  183. Platt, E. J., Wehrly, K., Kuhmann, S. E., Chesebro, B., Kabat, D. (1998) Effects of CCR5 and CD4 cell surface concentrations on infections by macrophage-tropic isolates of human immunodeficiency virus type 1 J. Virol. 72,2855-2864[Abstract/Free Full Text]
  184. 93
  185. Hibbitts, S., Reeves, J. D., Simmons, G., Gray, P. W., Epstein, L. G., Schols, D., de Clercq, E., Wells, T. N., Proudfoot, A. E., Clapham, P. R. (1999) Coreceptor ligand inhibition of fetal brain cell infection by HIV type 1 AIDS Res. Hum. Retroviruses 15,989-1000[Medline]
  186. 94
  187. Lathey, J. L., Pratt, R. D., Spector, S. A. (1997) Appearance of autologous neutralizing antibody correlates with reduction in virus load and phenotype switch during primary infection with human immunodeficiency virus type 1 J. Infect. Dis. 175,231-232[Medline]
  188. 95
  189. Fauci, A. S. (1996) Host factors and the pathogenesis of HIV-induced disease Nature 384,529-534[Medline]
  190. 96
  191. Klasse, P. J., Boyd, M. T., Weiss, R. A., Schulz, T. F. (1996) Mutations in the vpu, env, and nef genes of a syncytium-inducing variant of HIV type 1 JR-CSF that infects a range of T cell lines AIDS Res. Hum. Retroviruses 12,347-350[Medline]
  192. 97
  193. Harrowe, G., Cheng-Mayer, C. (1995) Amino acid substitutions in the V3 loop are responsible for adaptation to growth in transformed T-cell lines of a primary human immunodeficiency virus type 1 Virology 210,490-494[Medline]
  194. 98
  195. Weiss, S. H., Goedert, J. J., Gartner, S., Popovic, M., Waters, D., Markham, P., di Marzo Veronese, F., Gail, M. H., Barkley, W. E., Gibbons, J., et al (1988) Risk of human immunodeficiency virus (HIV-1) infection among laboratory workers Science 239,68-71[Abstract/Free Full Text]
  196. 99
  197. Miller, E., Duus, K., Su, L. (2000) In vivo selected HIV-1 isolate shows altered tropism without shift in co-receptor use. In 7th Conference on Retroviruses and Opportunistic Infections, San Francisco. Abstract 413.
  198. 100
  199. Schubert, U., Clouse, K. A., Strebel, K. (1995) Augmentation of virus secretion by the human immunodeficiency virus type 1 Vpu protein is cell type independent and occurs in cultured human primary macrophages and lymphocytes J. Virol. 69,7699-7711[Abstract/Free Full Text]
  200. 101
  201. Westervelt, P., Henkel, T., Trowbridge, D. B., Orenstein, J., Heuser, J., Gendelman, H. E., Ratner, L. (1992) Dual regulation of silent and productive infection in monocytes by distinct human immunodeficiency virus type 1 determinants J. Virol. 66,3925-3931[Abstract/Free Full Text]
  202. 102
  203. Schubert, U., Ferrer-Montiel, A. V., Oblatt-Montal, M., Henklein, P., Strebel, K., Montal, M. (1996) Identification of an ion channel activity of the Vpu transmembrane domain and its involvement in the regulation of virus release from HIV-1-infected cells FEBS Lett 398,12-18[Medline]
  204. 103
  205. Schubert, U., Anton, L. C., Bacik, I., Cox, J. H., Bour, S., Bennink, J. R., Orlowski, M., Strebel, K., Yewdell, J. W. (1998) CD4 glycoprotein degradation induced by human immunodeficiency virus type 1 Vpu protein requires the function of proteasomes and the ubiquitin-conjugating pathway J. Virol. 72,2280-2288[Abstract/Free Full Text]
  206. 104
  207. Lama, J., Mangasarian, A., Trono, D. (1999) Cell-surface expression of CD4 reduces HIV-1 infectivity by blocking Env incorporation in a Nef- and Vpu-inhibitable manner Curr. Biol. 9,622-631[Medline]
  208. 105
  209. Iwatani, Y., Song, S. K., Wang, L., Planas, J., Sakai, H., Ishimoto, A., Cloyd, M. W. (1997) Human immunodeficiency virus type 1 Vpu modifies viral cytopathic effect through augmented virus release J. Gen. Virol. 78,841-846[Abstract]
  210. 106
  211. Schubert, U., Bour, S., Willey, R. L., Strebel, K. (1999) Regulation of virus release by the macrophage-tropic human immunodeficiency virus type 1 AD8 isolate is redundant and can be controlled by either Vpu or Env J. Virol. 73,887-896[Abstract/Free Full Text]
  212. 107
  213. Bour, S., Schubert, U., Peden, K., Strebel, K. (1996) The envelope glycoprotein of human immunodeficiency virus type 2 enhances viral particle release: a Vpu-like factor? J. Virol. 70,820-829[Abstract/Free Full Text]
  214. 108
  215. Dyer, W. B., Ogg, G. S., Demoitie, M. A., Jin, X., Geczy, A. F., Rowland-Jones, S. L., McMichael, A. J., Nixon, D. F., Sullivan, J. S. (1999) Strong human immunodeficiency virus (HIV)-specific cytotoxic T-lymphocyte activity in Sydney Blood Bank Cohort patients infected with nef-defective HIV type 1 J. Virol. 73,436-443[Abstract/Free Full Text]
  216. 109
  217. Learmont, J. C., Geczy, A. F., Mills, J., Ashton, L. J., Raynes-Greenow, C. H., Garsia, R. J., Dyer, W. B., McIntyre, L., Oelrichs, R. B., Rhodes, D. I., Deacon, N. J., Sullivan, J. S. (1999) Immunologic and virologic status after 14 to 18 years of infection with an attenuated strain of HIV-1. A report from the Sydney Blood Bank Cohort N. Engl. J. Med. 340,1715-1722[Abstract/Free Full Text]
  218. 110
  219. Desrosiers, R. C., Lifson, J. D., Gibbs, J. S., Czajak, S. C., Howe, A. Y., Arthur, L. O., Johnson, R. P. (1998) Identification of highly attenuated mutants of simian immunodeficiency virus J. Virol. 72,1431-1437[Abstract/Free Full Text]
  220. 111
  221. Wyand, M. S., Manson, K., Montefiori, D. C., Lifson, J. D., Johnson, R. P., Desrosiers, R. C. (1999) Protection by live, attenuated simian immunodeficiency virus against heterologous challenge J. Virol. 73,8356-8363[Abstract/Free Full Text]



This article has been cited by other articles:


Home page
J. Leukoc. Biol.Home page
L. J. Montaner, C.-F. Perno, and S. Crowe
Macrophage infection by HIV-1: focus on viral reservoirs and pathogenesis
J. Leukoc. Biol., September 1, 2000; 68(3): 301 - 302.
[Full Text] [PDF]


This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF) Free
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Dejucq, N.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Dejucq, N.